KEGG   Alteromonas mediterranea DE: MADE_1009480Help
Entry
MADE_1009480      CDS       T00747                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
amc  Alteromonas mediterranea DE
Pathway
amc00020  Citrate cycle (TCA cycle)
amc00190  Oxidative phosphorylation
amc00650  Butanoate metabolism
amc01100  Metabolic pathways
amc01110  Biosynthesis of secondary metabolites
amc01120  Microbial metabolism in diverse environments
amc01130  Biosynthesis of antibiotics
amc01200  Carbon metabolism
Module
amc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MADE_1009480 (sdhD)
   00650 Butanoate metabolism
    MADE_1009480 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    MADE_1009480 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AEA98034
UniProt: F2GC18
Position
2139148..2139495
Genome map
AA seq 115 aa AA seqDB search
MVTNQASIKRDGVQDYVSLRATAAIIFAYSVFMAWFFITTDNLTFIEWRGLFSGLAMKVF
TLAALVAVMIHVRIGLWQVLTDYVKATGLRAVLQYILNIIAFGYVAVGLFVLWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaaccaagcaagcataaagcgtgacggcgtacaagactacgtatctcttcgc
gcaacagcagcgataattttcgcgtactcggttttcatggcgtggttttttattaccacc
gataacttaacgtttatcgaatggcgaggtttgttctctggcctagctatgaaagttttc
acattggcagcactagtagcagtgatgatccacgtgcgtatcggcctttggcaggtactt
acagactatgttaaagcgacaggtctacgtgcggtactacaatatatattaaatatcatc
gcgttcggctacgtagctgtgggcctattcgtattgtggggagtgtaa

DBGET integrated database retrieval system