KEGG   Alteromonas mediterranea DE: MADE_1016165Help
Entry
MADE_1016165      CDS       T00747                                 

Definition
(GenBank) 1,4-alpha-glucan branching protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
amc  Alteromonas mediterranea DE
Pathway
amc00500  Starch and sucrose metabolism
amc01100  Metabolic pathways
amc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MADE_1016165
Enzymes [BR:amc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MADE_1016165
Exosome [BR:amc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MADE_1016165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase CBM_48 AMPK1_CBM Glyco_hydro_31 RGCC
Motif
Other DBs
NCBI-ProteinID: AEA99363
UniProt: F2G3G6
Position
complement(3575688..3577559)
Genome map
AA seq 623 aa AA seqDB search
MGLAVFIIGTSVAQLTDSIRVVANYAMQSSFLFIPSRWSANKMCENSIGPGVVKTQTGYR
FSVWAPNAQSVSLTGDFNDWNRPGISMQRQDNGVWWCETDDAKCGHEYKYDVTNAKGDSV
LKNDPRARLMTNSVGNSVIYDDAFRWEVEDFKPAPIHQRIIYELHIGTFHRKNGEQGTFD
SAIEKLDYLASLGVNMIELMPVNEFAGDISWGYNPACPFAVEEAYGGPDGLKRFIDAAHK
HGIGVIMDVVYNHFGPSDLDIWQFDGWSENDKGGIYFYNDERSATPWGDTRPDYGRQEVR
DYITDNALMWLQEFKADGLRMDMVPFMRTVSGADSGEDDIPEAYELIKGINGFIQHACGE
KMTIAEDLHQHDYITDPLDGGGCGYTAQWDAAFVHPVREVLTQSDDENVNLDVLVDALCK
QYSASPFARVVYTESHDEVANGKARLVEEVAPGNVDDDYFARQKGVLAATLVLTSAGIPM
LFQGQEFKETGWFNDTKDLDWSRRNSFDEYLEAITELVNLRKGEDKATTGLTGANTEVVH
RDSKNKVLGYRRFNDIANESVWVYLHLGGEDIDDYQLSGVPVDPHCLFAWSDGLCTQSVH
INNRKVRLPSFGIFIFTERGNLG
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgggcttggcggttttcattattggcacttcagttgcacaactaacggactctattaga
gtcgtcgctaattacgcgatgcaatcctcttttttattcattccttcgcgttggagcgct
aataaaatgtgtgagaattcaataggtccaggtgtagtaaaaacacaaactggatatcgt
ttttccgtatgggcgcctaatgcacaaagcgtctcactaactggagattttaatgactgg
aatcgccctggtatcagtatgcagaggcaagataacggtgtgtggtggtgtgaaactgat
gatgctaaatgtggccatgaatacaagtatgacgtgactaatgctaaaggtgatagcgtt
ttaaaaaacgaccctagggcacggttgatgaccaatagtgtaggcaatagcgttatttat
gacgatgcctttagatgggaggtagaagactttaaacctgctccaattcatcaacgaata
atctatgagcttcatattggcacatttcaccgcaaaaacggtgagcaaggtacatttgac
tcggccatagagaagcttgattacttagcttcgctaggcgtaaatatgatagagcttatg
ccagtaaatgaatttgctggcgatatcagttgggggtacaacccagcatgcccatttgcc
gttgaagaagcttatggtgggccagatggcctaaaacgctttatcgacgccgcgcataaa
cacggcataggcgtaataatggacgttgtatataaccatttcggcccaagcgacttggat
atttggcagtttgacggctggagcgagaacgacaaggggggaatttatttctacaacgac
gaacgctccgctaccccatggggagacacgcgacctgactatggccgtcaagaagtaaga
gattatattaccgacaatgccttaatgtggcttcaagagtttaaagcagatgggctgcgt
atggatatggtgcctttcatgcgtaccgtctctggtgcagactcaggggaagatgatatt
ccagaagcttatgagctaattaagggaataaatgggttcattcaacacgcatgcggtgaa
aaaatgacaattgctgaagacctccaccagcacgattacattacagatcccttagacggt
ggaggctgcggttacactgcgcaatgggacgctgcatttgtacacccagtacgtgaagta
ctaactcaatctgatgatgaaaacgtcaatcttgatgtactcgtcgatgcgttatgcaaa
caatacagcgctagcccctttgctagagttgtctataccgaatctcacgatgaagtggct
aacggtaaagctcgccttgtcgaagaagttgcgcctggaaatgtagatgacgattatttt
gcgcgtcaaaaaggcgtgttagcagccacgctggtgcttacaagcgccggtattcctatg
ctgtttcaagggcaagaatttaaagagacggggtggtttaacgatacaaaagacttggat
tggtcacggcgcaatagttttgatgaatacttggaggcaatcacggaactggttaactta
cgtaaaggtgaagataaagctaccaccgggctaactggcgcaaatacagaggttgttcat
cgagacagtaaaaacaaagtcttgggttatcgccgtttcaatgacatcgccaatgagtcg
gtgtgggtgtatctgcatctggggggcgaagacatagatgattatcagttatcaggggtg
ccggtcgaccctcattgtttatttgcatggtcagacgggttgtgtacgcagtctgttcat
ataaataacaggaaagtaaggcttccatcattcggtattttcatttttactgagcggggt
aacctaggctaa

DBGET integrated database retrieval system