KEGG   Amycolatopsis mediterranei U32: AMED_0560Help
Entry
AMED_0560         CDS       T01269                                 

Gene name
hemL
Definition
(RefSeq) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00860  Porphyrin and chlorophyll metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
Module
amd_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
amd_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMED_0560 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amd01007]
    AMED_0560 (hemL)
Enzymes [BR:amd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     AMED_0560 (hemL)
Amino acid related enzymes [BR:amd01007]
 Aminotransferase (transaminase)
  Class III
   AMED_0560 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 9434774
NCBI-ProteinID: YP_003762782
UniProt: A0A0H3CWF9
Position
complement(571177..572493)
Genome map
AA seq 438 aa AA seqDB search
MGTNLPRSTQVDERLHRVIPGGAHTYAKGSDQYPEGMAPVISHGRGGHVWDVDGNEYVEY
GAGLRAVSLGHAHPRVIEAVRGELEKGSNFIRPSIIEAEAAERFLENVPTADMVKFTKNG
SDATTAAVRLARATTGRKLVAKCADHAFFSTDDWFIGTTPMNAGIPDETTEQTVSFPYGD
LQAAEQLLQRHDGEIACMILEAAAAAEPPPGYLQGLRELTTRHGVVLIFDEMITGFRWSA
HGAQGLYGVTPDLSTFGKALGNGFAVSALAGKRELMEIGGLRTGRERVFLLSTTHGAETH
SLAAAMAVMDVYRDEDVIGRMHALGDRLAAGVREVAAGIGVEDHVVVRGRASNLVFGTLD
EQGHPSQPYRTLFLRELISGGVLGPSFVVSAALTEADIDKTIDVVAQACTVYRKALDAND
PAPWMGGRPVQPVFRKYA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgaacctgccccgctccacacaggtggacgagcggctgcaccgggtcatcccg
ggcggtgcgcacacctacgccaagggctcggaccagtatcccgaagggatggccccggtc
atctcccacggccgcggcgggcacgtctgggacgtcgacggcaacgagtacgtcgagtac
ggcgcgggtctgagggcggtcagcctcggccacgcccacccgcgggtcatcgaggcggtg
cgcggcgagctggagaagggcagcaacttcatccggccctcgatcatcgaagccgaggcc
gccgagcggttcctcgagaacgtgccgacggccgacatggtgaagttcaccaagaacggc
tcggacgcgacgaccgccgcggtgcggctggcccgcgccaccaccggccgcaagctcgtc
gccaagtgcgccgaccacgccttcttctcgaccgacgactggttcatcggcaccacgccg
atgaacgcgggcatcccggacgagacgaccgagcagacggtgtccttcccgtacggcgac
ctgcaggccgcggagcagctgctgcagcgccacgacggcgagatcgcgtgcatgatcctg
gaggcggccgcggcggcggaaccgccgccggggtacctgcagggcctgcgcgagctcacc
acccggcacggcgtcgtcctgatcttcgacgaaatgatcaccggcttccggtggtccgcc
cacggcgcgcagggcctctacggcgtcacgcccgacctctccacgttcggcaaggcgctc
ggcaacggcttcgcggtgtcggcgctggcgggcaagcgggaactgatggagatcggcggc
ctgcgcaccggccgcgagcgggtgttcctgctctcgaccacgcacggcgcggagacccac
tcgctggccgccgcgatggcggtcatggacgtctaccgcgacgaagacgtcatcggccgc
atgcacgcactcggcgaccggctcgccgccggcgtccgcgaggtggcggccgggatcggc
gtcgaagaccacgtcgtcgtccgtggccgggccagcaacctcgtcttcggcacgctcgac
gagcagggccacccctcgcagccgtaccggacgctgttcctgcgcgagctgatcagcggc
ggggtgctcggaccgtccttcgtggtcagcgccgcgctcaccgaggcggacatcgacaag
accatcgacgtcgtcgcccaggcctgcacggtgtaccgcaaggccctcgacgcgaacgac
ccggcgccgtggatgggcggccgcccggtgcagcccgtgttccgcaaatacgcctga

DBGET integrated database retrieval system