KEGG   Amycolatopsis mediterranei U32: AMED_0851Help
Entry
AMED_0851         CDS       T01269                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00020  Citrate cycle (TCA cycle)
amd00190  Oxidative phosphorylation
amd00650  Butanoate metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01200  Carbon metabolism
Module
amd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMED_0851 (sdhD)
   00650 Butanoate metabolism
    AMED_0851 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    AMED_0851 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Ninjurin Virul_fac_BrkB
Motif
Other DBs
NCBI-GeneID: 9435069
NCBI-ProteinID: YP_003763073
UniProt: A0A0H3CZG1
Position
complement(908606..909019)
Genome map
AA seq 137 aa AA seqDB search
MADLALANPRAPKRPAARRSNFELYSWLFMRISGLVLVILVLGHLLIMNILDGGVHRINW
GFVAGRWASPFWQFWDLLMLWLAEIHGGNGLRTIIDDYARKDSTRFWLKILLYVSMVLIL
AVGTMVIFTFDPNMPAN
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggccgacctcgccctcgcgaacccgcgcgcgccgaagcgcccggccgcgcgccggagc
aacttcgagctctacagctggctgttcatgcggatctccgggctggtcctggtcatcctg
gtgctcggccacctgctgatcatgaacatcctcgacggcggcgtgcaccggatcaactgg
ggcttcgtcgccggccgctgggcctcgccgttctggcagttctgggacctgctgatgctg
tggctcgccgagatccacggcggcaacgggctgcgcacgatcatcgacgactacgcccgc
aaggacagcacgcggttctggctgaagatcctgctgtacgtctcgatggtgctgatcctg
gccgtcggcacgatggtgatcttcacgttcgacccgaacatgcccgcgaactaa

DBGET integrated database retrieval system