KEGG   Amycolatopsis mediterranei U32: AMED_1102Help
Entry
AMED_1102         CDS       T01269                                 

Definition
(RefSeq) metal-dependent phosphoesterase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
amd  Amycolatopsis mediterranei U32
Brite
KEGG Orthology (KO) [BR:amd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AMED_1102
Enzymes [BR:amd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     AMED_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-GeneID: 9435316
NCBI-ProteinID: YP_003763320
UniProt: A0A0H3CX65
Position
1157218..1158090
Genome map
AA seq 290 aa AA seqDB search
MDAMRIDLHAHSTASDGTDTPAGLVAAAAKAGLDVVAITDHDTTAGWAPASEAVSPGLTL
VPGAELSTVSIDPETGRQISVHLLAYLFDPTSEPVVTEQTRLRLERRTRLRRMAERMAAD
GLPIDADEIFGLLPEDSPPGRPHLAQALVRAGLVKSVDEAFADYLSPRRGYYVARRDTPV
EEAIDMIAAAGGVTVIAHPFAFSRGATISEDTLAGLAARGLTGVEADHPNHDAPTRARTR
ELAGELGLLVTGSSDYHGTNKTIALGECTTDPGQFEELTSRATGFQVVKG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgatgcgcatcgatctgcacgcccactccaccgcttccgacggcaccgacacg
ccggccgggctcgtcgccgcggccgcgaaagccgggctcgacgtcgtcgcgatcaccgac
cacgacaccaccgcgggctgggcgcccgcttccgaagcggtgtcacccggcctgacgctg
gtccccggcgccgagctgtcgacggtgtcgatcgaccccgagaccggccggcagatcagc
gtccacctgctcgcctacctcttcgacccgacgtccgagccggtcgtcaccgagcagacc
cggctgcggctcgagcgccgcacgcgactgcggcggatggccgagcggatggccgccgac
ggcctcccgatcgacgccgacgagatcttcggcctgctgcccgaggattccccgcccggg
cgcccccacctggcccaggcgctggtccgggccgggctggtcaagtccgtcgacgaggcc
ttcgccgactacctcagcccccgccgcgggtactacgtcgcccgccgcgacacaccggtc
gaggaagccatcgacatgatcgccgcggccggcggtgtcacggtcatcgcgcaccccttc
gccttcagccgcggtgccacgatcagcgaggacaccctcgccgggctggccgcgcgcggg
ctgaccggcgtcgaggccgaccacccgaaccacgacgcgccgacgcgggcccgcacccgc
gagctggccggcgaactcggcctgctcgtcaccgggtccagcgactaccacggcaccaac
aagacgatcgcgctcggcgagtgcacgaccgaccccgggcagttcgaggagctcacttcg
cgcgccacggggttccaggtcgtgaagggctga

DBGET integrated database retrieval system