KEGG   Amycolatopsis mediterranei U32: AMED_1225Help
Entry
AMED_1225         CDS       T01269                                 

Definition
(RefSeq) inorganic phosphate transporter PiT family
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
amd  Amycolatopsis mediterranei U32
Brite
KEGG Orthology (KO) [BR:amd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AMED_1225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-GeneID: 9435441
NCBI-ProteinID: YP_003763442
UniProt: A0A0H3CY76
Position
1302296..1302550
Genome map
AA seq 84 aa AA seqDB search
MQPSLLVVVVVITALIFDFTNGFHDTANSMATSIATGALRTRVAVAISAVLNLVGAFLSV
EVAKTISSAWWTTPRSARRSSSAA
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaccctcgttgctggtcgtggtcgtcgtcatcacggccctcattttcgatttcacg
aacgggttccacgacaccgcgaactcgatggccacgtcgatcgccaccggggccctcaga
acccgcgtggccgtcgcgatctcggcggtgttgaacctggtcggcgcgttcctgtcggtc
gaggtcgccaagacgatctccagcgcctggtggacgacaccaagatcggcccggcgatcg
tcttcggcggcctga

DBGET integrated database retrieval system