KEGG   Amycolatopsis mediterranei U32: AMED_2326Help
Entry
AMED_2326         CDS       T01269                                 

Gene name
metF
Definition
(RefSeq) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00670  One carbon pool by folate
amd01100  Metabolic pathways
amd01120  Microbial metabolism in diverse environments
amd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AMED_2326 (metF)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     AMED_2326 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 9436533
NCBI-ProteinID: YP_003764525
UniProt: A0A0H3D0I0
Position
2481415..2482299
Genome map
AA seq 294 aa AA seqDB search
MTSVIERLRGDGPKFSIEFFPPRDTADEAVLWKAIRELEPYDPAYMSITYGAGGSSRDGT
IRSIARVATETTLVPMAHLTAVNHSVAELRNVIGWYASVGVRNILALRGDPPGDVYGDWI
PHPEGLQYAEELVQLVRSLGDFCVGVSAYTYGHPRSPDLETDTKYLVRKLRAGADFAIAQ
LFHGAEDFLRLRDRVAATGCDVPVLPGVMPLTTWRTLQTTIKLSGAPAPRKLLDRLEPLA
EDPKAFRAAGIDVTTELCEKLIAEGVPNLHFYTFNRSKATREVIARLGLVPARA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcggtgatcgagcggttgcgaggagacgggccgaagttctccatcgagttcttc
ccaccccgggacacggcggacgaggccgtcctctggaaggcgatccgggagctcgagccg
tacgacccggcctacatgtcaatcacctacggcgccggcggctccagccgcgacggcacg
atccgcagcatcgcccgcgtcgcgaccgagacgacgctggtgccgatggcacacctgacc
gcggtcaaccactccgtcgccgagctgcgcaacgtgatcggctggtacgcctcggtcggc
gtccgcaacatcctcgccctgcgcggcgacccgccgggcgacgtctacggcgactggatc
ccgcacccggagggcctccagtacgccgaagagctggtccagctggtgcgctcgctcggt
gacttctgcgtcggcgtgtcggcgtacacctacggacacccgcgctcgccggacctcgaa
acggacacgaagtacctggtccgcaagctgcgggcgggcgcggacttcgcgatcgcgcag
ctgttccacggcgccgaggacttcttgcggctgcgcgaccgggtcgccgcgaccggctgt
gacgtgccggtgctgcccggcgtgatgccgctgacgacgtggcggacgctgcagacgacg
atcaagctgtccggcgcgccggcgccccggaagctcctggaccggctcgaaccgctggcc
gaggaccccaaggcgttccgcgcggcgggcatcgacgtgaccacggaactgtgcgagaag
ctgatcgccgagggcgtgccgaacctgcacttctacacgttcaaccgctcgaaggcgacc
cgcgaggtgatcgcccggctcggcctcgtcccggcccgtgcttaa

DBGET integrated database retrieval system