KEGG   Amycolatopsis mediterranei U32: AMED_2806Help
Entry
AMED_2806         CDS       T01269                                 

Gene name
zwf
Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00030  Pentose phosphate pathway
amd00480  Glutathione metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01200  Carbon metabolism
Module
amd_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
amd_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
amd_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AMED_2806 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AMED_2806 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amd04147]
    AMED_2806 (zwf)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AMED_2806 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AMED_2806 (zwf)
Exosome [BR:amd04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AMED_2806 (zwf)
  Exosomal proteins of colorectal cancer cells
   AMED_2806 (zwf)
  Exosomal proteins of bladder cancer cells
   AMED_2806 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 9437011
NCBI-ProteinID: YP_003765003
UniProt: A0A0H3D321
Position
complement(2997136..2998659)
Genome map
AA seq 507 aa AA seqDB search
MTWTNPLRDPRDKRLPRIAGPSSLVIFGVTGDLARKKLMPAIYDLANRGLLPAGFSLVGF
ARRDWEHQDFGELVHDSVKEHARTPFKESVWNRLAEGIRFVQGTFDDDDAFDRLAQTVRD
LDHERGTGGNTAFYLSIPPGAFPVVTKQLARSGLANADENTWRRVVIEKPFGHDLKSAEE
LNAIVNDVFPEESVFRIDHYLGKETVQNILALRFANQLFEPIWNANYVDHVQITMAEDIG
LGGRAGYYDGIGAARDVIQNHLLQLLAFTAMEEPLSFDPRALRAEKIKVLSGTKPLGPLG
KTTARGQYAGGWQGGTKVPGLLQEEGFAKDSKTETYAAVTLEVQSRRWAGVPFYLRTGKR
LGRRVTEIAVVFKRAPHLPFDSTSTEELGQNALVIRVQPDEGITLRFGSKVPGTTMEVRD
VTMDFGYGHAFTESSPEAYERLILDVLLGEPSLFPVNEEVELSWKILDPILEHWAKEGAP
EQYAPGTWGPPSADEMLERTGRKWRRP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacctggaccaatccgctgcgcgatccgcgggacaagcggctcccgcgcatcgccggg
ccgtccagcctggtgatcttcggggtcaccggcgacctggcccgcaagaagctgatgccc
gccatctacgacctggccaaccgcgggctgctgcccgcgggcttctcgctcgtcgggttc
gcccgccgcgactgggagcaccaggacttcggcgagctcgtgcacgactcggtcaaggag
cacgcgcggacgccgttcaaggagtcggtgtggaaccggctcgccgaaggcatccggttc
gtgcagggcaccttcgacgacgacgacgccttcgaccggctcgcgcagacggtccgcgac
ctcgaccacgaacgcggcaccggcggcaacaccgcgttctacctgtcgatcccgcccggc
gcgttcccggtggtgaccaagcagctggcccgctccgggctggcgaacgccgacgagaac
acctggcggcgggtcgtcatcgagaagcccttcgggcacgacctgaagagcgccgaagag
ctcaacgcgatcgtcaacgacgtcttccccgaggagtcggtgttccgcatcgaccactac
ctcggcaaggagacggtgcagaacatcctggcgctgcgcttcgcgaaccagctgttcgag
ccgatctggaacgccaactacgtcgaccacgtgcagatcaccatggccgaggacatcggc
ctcggcgggcgcgcggggtactacgacggcatcggcgccgcccgggacgtcatccagaac
cacctgctgcagctgctggccttcaccgcgatggaggagccgctgtcgttcgacccgcgg
gccctgcgcgcggagaagatcaaggtgctctcgggcaccaaaccgctcgggccgctgggc
aagaccaccgcgcgcggccagtacgcgggcggctggcagggcggcacgaaggtgcccggc
ctgctgcaggaagagggcttcgcgaaggactcgaagaccgagacctacgccgcggtgacc
ctcgaggtgcagagccgccgctgggccggggtgccgttctacctgcgcaccggcaagcgg
ctcggccgccgcgtcaccgagatcgccgtcgtgttcaagcgggcgccgcacctgccgttc
gactcgacgtcgaccgaggagctggggcagaacgccctggtcatccgggtccagccggac
gagggcatcacgctgcggttcggctcgaaggtgccggggaccacgatggaggtccgcgac
gtcacgatggacttcgggtacggccacgcgttcaccgagtcctcccccgaggcctacgag
cggctgatcctggacgtcctgctcggcgagccgtcgctgttcccggtgaacgaagaggtc
gagctctcctggaaaatcctcgacccgatcctcgagcactgggcgaaggaaggcgcgccc
gagcagtacgcgccgggcacgtggggtccgccgtccgccgacgaaatgctggagcgcacc
ggccggaaatggaggcgcccgtga

DBGET integrated database retrieval system