KEGG   Amycolatopsis mediterranei U32: AMED_2823Help
Entry
AMED_2823         CDS       T01269                                 

Gene name
desC
Definition
(RefSeq) stearoyl-CoA desaturase (delta-9 desaturase)
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd01040  Biosynthesis of unsaturated fatty acids
amd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AMED_2823 (desC)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     AMED_2823 (desC)
Lipid biosynthesis proteins [BR:amd01004]
 Desaturase
  First
   AMED_2823 (desC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 9437027
NCBI-ProteinID: YP_003765019
UniProt: A0A0H3D319
Position
complement(3014890..3015807)
Genome map
AA seq 305 aa AA seqDB search
MTSRTAPKPLISHRRGTGEMIVLKTFLLVPFAALLIAVPLVWGWGMSWIDLILAAAFYTF
ATLGVTVGFHRYFTHGAFKASRPLRVLLAIAGSMAVQGSVIFWVASHRRHHAFADREGDP
HSPWLFGTSPSALLRGFWHAHMGWMFGREVTNADRFAPDLVADPDVRWVNRYFWLWITLS
LALPAVLGGLISWSWWGVVTAFFWAGLVRIAFLHHVTWSVNSVCHLIGERPFASRDKAAN
FWPLALLSMGESWHNSHHADPTCARHGVLRGQVDVSARVIWAFERFGWATDVRWPRADRL
AAKRA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgcgcaccgcgcccaagccgctgatctcccaccgccgcggcaccggcgagatg
atcgtgctcaagaccttcctgctggtgccgttcgcggccctgctcatcgcggtcccgctg
gtgtggggctggggcatgagctggatcgacctcatcctcgcggcggcgttctacacgttc
gcaacgctcggggtgacggtcggcttccaccggtacttcacccacggcgcgttcaaggcg
tcgcgtcccctgcgggtgctgctggccatcgcgggcagcatggcggtgcagggctcggtg
atcttctgggtggccagtcaccgccgccaccacgcgttcgccgaccgcgagggcgacccg
cactcgccgtggctgttcggcacttccccgtcggccctgctgcgcggcttctggcacgcg
cacatgggctggatgttcggccgcgaggtgaccaacgcggaccgcttcgcccccgacctg
gtggcggacccggacgtccgctgggtgaaccggtacttctggctgtggatcacgttgagc
ctggccctgccggcggtcctgggcggcctgatctcgtggtcctggtggggcgtggtgacg
gcgttcttctgggcgggcctggtgcgcatcgcgttcctgcaccacgtgacgtggtcggtg
aactcggtctgccacttgatcggcgagaggccgttcgccagccgcgacaaggcggcgaac
ttctggccgctggcgttgctgtcgatgggcgagtcctggcacaactcccaccacgcggat
ccgacgtgcgcccggcacggggtgctgcgggggcaggtggacgtttcggcgcgggtgatc
tgggcgttcgagcggttcgggtgggcgaccgacgtgcggtggccgcgagcggaccggctg
gccgcgaagcgggcctga

DBGET integrated database retrieval system