KEGG   Amycolatopsis mediterranei U32: AMED_4130Help
Entry
AMED_4130         CDS       T01269                                 

Gene name
cheB
Definition
(RefSeq) chemotaxis-specific methylesterase CheB
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd02020  Two-component system
amd02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:amd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AMED_4130 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AMED_4130 (cheB)
Enzymes [BR:amd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AMED_4130 (cheB)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     AMED_4130 (cheB)
Two-component system [BR:amd02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   AMED_4130 (cheB)
Bacterial motility proteins [BR:amd02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AMED_4130 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest
Motif
Other DBs
NCBI-GeneID: 9438319
NCBI-ProteinID: YP_003766309
UniProt: A0A0H3D6E8
Position
4538751..4539341
Genome map
AA seq 196 aa AA seqDB search
MTPDFPLRFPVVALVTSAGGLDALTRVLAPLPADFPAAVLVAQHLDPARTSHLTAILAAR
TALRVGEAADGDVLVAGAALVVPAGRHLLVTSDARIGLLDTGDLPPARPSADLLLATLAV
TCGPRALAVVLTGKGTDAQTGIRAIAHCGGTVFAQDEGTSAHFGMPGAAIGTGLVHAVLP
LSGIAAAILEHVARHA
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgacaccggacttcccgctgcggttcccggtcgtcgccctggtcacgtccgccggtggc
ctcgatgcgctcacccgggtgctcgccccgctgcccgcggacttccccgcggcggtgctc
gtcgcccagcacctggatccggcccggacgagccacctcaccgccatcctcgccgcacgc
accgcgctgcgggtcggcgaggccgctgacggagacgtgctcgtggccggtgcggcactg
gtcgtccccgcggggcggcacctgctggtcacgtcggacgcccggatcgggctgctggac
accggtgatctgccgccggcgcggccgtcggcggatctgctgctggccaccctcgccgtc
acctgcgggccccgtgcgctggcggtcgtcctgacgggcaagggcaccgacgcccagacc
gggatccgggcgatcgcgcactgcggaggcacggtgttcgcccaggacgaggggacgtcc
gcgcacttcggcatgccgggcgccgcgatcggcaccgggctcgtccacgccgtgctcccg
ctgtccggcatcgccgcggccatcctggagcacgtcgcccggcatgcttga

DBGET integrated database retrieval system