KEGG   Amycolatopsis mediterranei U32: AMED_7199Help
Entry
AMED_7199         CDS       T01269                                 

Gene name
paaG
Definition
(RefSeq) enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00071  Fatty acid degradation
amd00280  Valine, leucine and isoleucine degradation
amd00281  Geraniol degradation
amd00310  Lysine degradation
amd00360  Phenylalanine metabolism
amd00362  Benzoate degradation
amd00380  Tryptophan metabolism
amd00410  beta-Alanine metabolism
amd00627  Aminobenzoate degradation
amd00640  Propanoate metabolism
amd00650  Butanoate metabolism
amd00903  Limonene and pinene degradation
amd00930  Caprolactam degradation
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01212  Fatty acid metabolism
Module
amd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMED_7199 (paaG)
   00650 Butanoate metabolism
    AMED_7199 (paaG)
  Lipid metabolism
   00071 Fatty acid degradation
    AMED_7199 (paaG)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMED_7199 (paaG)
   00310 Lysine degradation
    AMED_7199 (paaG)
   00360 Phenylalanine metabolism
    AMED_7199 (paaG)
   00380 Tryptophan metabolism
    AMED_7199 (paaG)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMED_7199 (paaG)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMED_7199 (paaG)
   00281 Geraniol degradation
    AMED_7199 (paaG)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMED_7199 (paaG)
   00627 Aminobenzoate degradation
    AMED_7199 (paaG)
   00930 Caprolactam degradation
    AMED_7199 (paaG)
Enzymes [BR:amd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AMED_7199 (paaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 9441350
NCBI-ProteinID: YP_003769318
UniProt: A0A0H3DDY9
Position
complement(7944162..7944956)
Genome map
AA seq 264 aa AA seqDB search
MIEDPGAVGLGCRWADGVLWLTLDRPEARNALTIAMRRGLITAIRAADADPQTRVVVLTG
TDPAFSAGVDLKESLGAPRGARTDPAEAVRAARAPVLGVINGPCYTGALELALSCDFLVA
SDRARFADTHAALGLVAGWGMSALLPRAVGVRLARQMMLTGEPVDAGQAVRAGLVNEVVP
HERLAERVRQVVAGILAAAPEAADATLQLLADGEDVPLAHALALEARAKRRRRIDVAEVA
RRFAARTAHVSDHNGMMRTGAEDR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaggatccgggcgccgtcgggctcgggtgccgctgggcggacggggtgctctgg
ctgactctggaccgcccagaggcgcgcaacgcgctgacgatcgcgatgcggcgcggactg
atcaccgcgatccgggcggcggacgcggatccgcagacgcgggtggtcgtgctgaccggg
accgatccggccttctccgcgggcgtcgacctcaaggagtcgctcggggcgccgcgcggc
gcccggaccgacccggcggaggcggtgcgggcggctcgcgctccggtgctcggggtgatc
aacggcccgtgttacaccggagcgctggagctggcgctgtcgtgcgacttcctcgtcgcc
tcggaccgcgcccggttcgccgacacgcacgccgcgctcggcctggtggccgggtggggg
atgagcgcgctgctgccccgggcggtcggcgtgcggctggcccggcagatgatgctgacc
ggcgagcccgtcgacgctgggcaggcggtgcgtgctgggctggtgaatgaggtcgtgccc
cacgagcggctggcggagcgggtccggcaggtcgtggccgggatcctcgccgccgcgccg
gaagcggccgacgccacgctgcagctgctcgccgacggcgaggacgtgcccctggcgcac
gctctcgcgctggaggcgagggcgaagcggcggcggcggatagacgtggcggaggtggcc
cgccggttcgcggcccggaccgctcacgtaagtgaccacaatggaatgatgcgcacggga
gcggaggaccgatga

DBGET integrated database retrieval system