KEGG   Amycolatopsis mediterranei U32: AMED_9218Help
Entry
AMED_9218         CDS       T01269                                 

Gene name
pdhC
Definition
(RefSeq) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00010  Glycolysis / Gluconeogenesis
amd00020  Citrate cycle (TCA cycle)
amd00620  Pyruvate metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01200  Carbon metabolism
Module
amd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMED_9218 (pdhC)
   00020 Citrate cycle (TCA cycle)
    AMED_9218 (pdhC)
   00620 Pyruvate metabolism
    AMED_9218 (pdhC)
Enzymes [BR:amd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AMED_9218 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-GeneID: 9443354
NCBI-ProteinID: YP_003771309
UniProt: A0A0H3DL08
Position
10071739..10073028
Genome map
AA seq 429 aa AA seqDB search
MPTYKQFPLADTAEGLTEADILSWHVKPGDTVTVNQIVVEIETAKAAVELPIPWAGVVTE
LHVEPGQTVEVGTPILTIDIDPGGASAAPAPVEEPAEEEMKPLVGYGSKTVVTQRRARKG
AAPEPAPAVAVAAPPAPVAPRGGYVPLAKPPVRKLAKDLGVDLHALTGTADGGVITREDV
ERAANETPVAPSVVDSGARERRVPIKGVRKMTAAAMVQSAYTAPHVTEFLTIDVTPMMEF
REKLKKSREFAGVKVTPLTFAAKAVCLAAKRTPDVNAVWDEQAQEIVYKDYVHLGIAAAT
PRGLIVPKVRDADSMSLKELAQALTTLTDVAREGKTSPADMANGTITITNVGVFGVDTGT
PIINPGESAILCLGAIKDQPWVVDGEIKVRKVLQLSLSFDHRVVDGQQGSEFLADVGALL
ADPAMAMTY
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgtacaaacaattccccttggccgacacggcggagggactgaccgaagccgac
atcctgtcctggcacgtgaagccgggcgacaccgtgacggtgaaccagatcgtggtcgag
atcgagaccgcgaaggccgccgtcgagctgccgatcccgtgggccggggtcgtcacggag
ctgcacgtcgagccggggcagacggtggaggtcggcacgccgatcctcaccatcgacatc
gaccctggcggtgcttccgctgcacccgcacccgtcgaggagccggccgaggaggagatg
aaaccgctggtcggctacggctccaagacggtcgtcacgcagcggcgcgcccgaaaaggc
gcagctcccgagcctgctccggccgttgccgtcgctgctcctccggcgcctgtggctccc
cgcggcgggtacgtcccgctcgcgaagccgccggtacggaagctcgcgaaggatctcggc
gtcgatctgcacgcgctcaccggcactgcggacggcggcgtgatcacgcgtgaggatgtc
gagcgcgccgcgaacgagactccagtcgcaccttcggttgtcgacagcggagcgcgcgag
cggcgcgtgccgatcaagggtgtccggaagatgaccgcggccgcgatggtgcagagcgcg
tacaccgctccgcacgtcacggagttcctgaccatcgacgtcacgccgatgatggagttc
cgcgagaagctgaagaagtcgcgggagttcgccggggtcaaggtcacgccgctgacgttc
gccgcgaaggccgtgtgcctggcggcgaagcgcactccggacgtcaacgcggtctgggac
gagcaggcgcaggagatcgtctacaaggactacgtgcacctcgggatcgcggcggcgaca
ccccgcggcctgatcgtgccgaaggtccgtgacgccgactcgatgtcgctgaaggaactg
gctcaggcgctgacgacgctgaccgacgtcgcccgggagggcaagacgtccccggcggac
atggcgaacggcacgatcacgatcacgaacgtgggcgtgttcggcgtcgacaccggaacg
ccgatcatcaacccgggcgagtccgcgatcctgtgcctcggcgcgatcaaggaccagccg
tgggtggtggacggcgagatcaaggtccgcaaggtcctccagctgtcgctgagcttcgac
caccgcgtggtcgacggccagcagggctcggagttcctcgccgacgtcggcgcactgctg
gccgacccggcgatggcgatgacgtactga

DBGET integrated database retrieval system