KEGG   Apis mellifera (honey bee): 100577002Help
Entry
100577002         CDS       T01057                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00010  Glycolysis / Gluconeogenesis
ame00562  Inositol phosphate metabolism
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100577002
   00562 Inositol phosphate metabolism
    100577002
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100577002
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100577002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF3397
Motif
Other DBs
NCBI-GeneID: 100577002
NCBI-ProteinID: XP_006565014
BEEBASE: GB51841
UniProt: A0A088AJX2
AA seq 466 aa AA seqDB search
MNAYVLFLALLISHVYARDVDYCFKEENDPYLYMATKTAYHFVYHKGRFQDVPNCQAKQI
WMLVTHGTRCSSKSEIMEMLKLKDFQKEIINNHELRNNGHLCNKDLENLKKWNPNEYLMI
ERAKVLAPQGVEDMRLLARRLQSSFPHLLQPNNNENITERDYVFKESDAYNSMGAFMEGL
FKSRDVVDSEKVPENDTLLTMYKMCDSWDNEYNNVSYEEVIAFEESEDFRNLVENVSRRL
GFLYIPKDSILTMYDMCRYEKAWTVTQLSPWCAVFSKEELHVLEYREDLYYYYKAGYGRE
INARLGCTLLQDMMNHFWKMEQEDESNQPKGVFYFSDTISLLNLLTTLNINKDQMQLKAF
NYKEMAKRQWRTSFMSSFAANLIAVFYKCDTISQPNKVMFYLAEKLVMIDGCDVGLCDWE
YIKQKFNPVLKQCDMKTCWNENGVPIFLPNFVLLILSCFSLIFIRE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcatacgtgctattcttggctttattaattagtcatgtttacgcgcgtgatgtt
gattactgttttaaggaagagaatgatccgtatttatacatggccactaaaactgcctac
catttcgtctatcacaaaggccgatttcaagacgtgcctaattgccaagcaaagcaaatt
tggatgctcgttacacatggcactcgatgctcttcaaagtcagaaatcatggaaatgctc
aaattaaaagatttccaaaaagaaataattaacaatcacgaattacgaaacaatggacac
ttgtgcaacaaggatttagaaaatttgaaaaaatggaacccgaacgaatatctgatgatc
gaacgagcgaaagttctggcaccgcagggtgtggaggatatgaggttgctcgcgagacga
ttgcaaagtagttttccccatcttctgcaaccgaacaataacgagaacattaccgagcga
gattacgtgtttaaagaatcggatgcgtacaacagtatgggcgcgtttatggagggattg
ttcaagagtagagacgtcgtggatagcgaaaaagttccagaaaatgacactttactcacg
atgtacaaaatgtgcgattcgtgggacaacgaatacaacaacgtttcctacgaggaggta
atcgctttcgaggagagcgaagatttcagaaatctcgtggagaacgtgagccgacgcctc
ggatttttgtacattcccaaagattcgattctaacgatgtacgatatgtgccgttacgaa
aaggcatggacagtgacgcaactctctccttggtgtgccgttttcagcaaagaggaactt
catgtgctcgagtatcgcgaggatctctactattattacaaagccggatatggacgtgaa
atcaatgctcggctaggatgcacgcttttgcaagacatgatgaatcacttttggaaaatg
gaacaggaggacgagtcgaatcagcccaaaggcgtattctattttagcgatactataagt
ctgttgaatcttttgacaacattgaacattaataaagatcaaatgcaactgaaggctttt
aattacaaggaaatggcgaaacgtcagtggagaacatccttcatgtcatctttcgctgcg
aatcttatcgctgtattctacaaatgcgacactatcagccaaccgaacaaagtgatgttt
tacctggccgagaaattggtcatgatcgacggatgtgacgtgggcctctgcgattgggaa
tatataaagcaaaagttcaatcccgtcctcaaacagtgcgatatgaaaacttgttggaac
gaaaacggtgtccccatttttctgcctaatttcgttctccttatcctttcatgcttctct
ttaatcttcatcagggaataa

DBGET integrated database retrieval system