KEGG   Apis mellifera (honey bee): 102654365Help
Entry
102654365         CDS       T01057                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial isoform X1
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00970  Aminoacyl-tRNA biosynthesis
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102654365
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ame03029]
    102654365
Enzymes [BR:ame01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     102654365
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     102654365
Mitochondrial biogenesis [BR:ame03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    102654365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 102654365
NCBI-ProteinID: XP_026297130
AA seq 527 aa AA seqDB search
MHMFSCRKTHLKNFIKNCYKDIYKKCDIQSISTDIREWKPTIGLEIHAQILTKSKLFSGA
STNFNCPINSSVSLFDCAIPGTMPVLNKKCVEAGILTALALSCEINAISMFERKHYFYSD
LPAGFQITQQKKPLAVNGEIKFNVFKPEIHKQPYTKSSKIKQIQLEQDSGRSFHNEVSGR
SLIDLNRAGIPLMELVFEPDLTNGEEAAALVKELCFILQLLGTCSCKMEEGALRVDANVS
VNKSNTSLGIRTEIKNIGSISAINRAIEYEIKRQISILEAGGQVINETRAWNPIDKKTIL
MREKEEKHDYRFMPEPNLLPLYLHIDNTMENKYNLINVPSLKEQLPELPEQIRQKLQNSL
TPHVFIAIMSDLELYLLFRNILNNGKHRKPQLVAQILISEVCAFIDEHKLNLAFCVCNQK
YIEKTIDLLQARIINQHILRKLLNKLLSESNKMPEQIIEENNWFMISNEEKLELLCLKVL
ETNPKWVKKYKRGNKKIFKKFLHEVVTLTEGCAEMVKVSKIMTRLLS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcatatgttttcatgtagaaaaactcacctaaaaaattttataaaaaattgttacaaa
gatatatataaaaaatgtgatattcaatctatttctacagatataagagaatggaagcct
acaataggtttagaaatacatgcacaaattttaacaaaatcaaaattattttctggagct
tctacaaattttaattgtccaattaattcttctgtgtcactttttgattgtgcaatacct
ggaacaatgccagttttaaataaaaaatgtgtagaagctggaatattaactgctttagct
ctttcatgtgaaataaatgctatctcaatgtttgagaggaaacattatttttattctgat
ttacctgcaggctttcaaattacgcaacaaaaaaaaccattagctgttaatggagaaatt
aaatttaatgtatttaagcctgaaatacataaacaaccttacacaaaatcatcaaaaatt
aagcaaatacaattagaacaagatagtggaagaagttttcataatgaagtttctggaaga
agtttaattgatcttaatcgagctggtatacctttaatggaattagtttttgagccagat
ttaacaaatggagaagaagcagcagctcttgtgaaagaactttgttttattttacaattg
ttaggcacatgttcatgtaaaatggaagaaggagccctaagagttgatgcaaatgtttct
gtaaacaaatctaatacatctttaggtattcgtactgagataaaaaacattggaagtata
agtgctatcaatcgtgctatagaatacgagataaaaagacaaatttctattttagaagca
ggaggtcaagttatcaatgaaactcgtgcatggaatccaatagacaaaaaaacaattctt
atgcgtgaaaaagaagaaaaacatgattatcgttttatgcctgaaccaaatttgctacca
ttatatttacacattgataataccatggaaaataaatataatctaattaatgtcccatct
ttaaaagagcaattaccagaattgccagaacaaatacgtcaaaaattacagaacagcctt
acaccacatgtatttatagcaataatgagtgatttagaattatatctattatttcgtaac
attttaaataatggtaaacatcgtaagcctcagttggtagctcaaattcttatttctgaa
gtatgtgcatttatagatgaacataaattgaatcttgcattttgtgtgtgtaatcagaaa
tatattgaaaagacaattgatttactacaagctagaataataaatcaacatatactaaga
aaattgttaaataaattacttagtgaatcaaataagatgccagaacagattattgaagaa
aataattggtttatgatatcaaatgaagagaaattagaattattatgtttaaaagtactt
gaaacaaatccaaaatgggtcaaaaaatataaaagaggaaataaaaagatatttaaaaag
tttctacatgaggtagttacacttactgaaggatgtgcagaaatggtcaaagtttcaaaa
attatgacaagattgttaagttaa

DBGET integrated database retrieval system