KEGG   Apis mellifera (honey bee): 406090Help
Entry
406090            CDS       T01057                                 

Gene name
Mrjp1, GB14888, p56kP-4
Definition
(RefSeq) major royal jelly protein 1
Organism
ame  Apis mellifera (honey bee)
SSDB OrthologParalogGFIT
Motif
Pfam: MRJP
Motif
Other DBs
NCBI-GeneID: 406090
NCBI-ProteinID: NP_001011579
BEEBASE: GB55205
UniProt: O18330 C6K481
Position
LG11
AA seq 432 aa AA seqDB search
MTRLFMLVCLGIVCQGTTGNILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYD
YKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSG
IVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATT
GKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKM
TIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQN
ILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIK
EALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCENPD
NDRTPFKISIHL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacaagattgtttatgctggtatgccttggcatagtttgtcaaggtacgacaggcaac
attcttcgaggagagtctttaaacaaatcattacccatccttcacgaatggaaattcttt
gattatgatttcggtagcgatgaaagaagacaagatgcaattctatctggcgaatacgac
tacaagaataattatccatccgacattgaccaatggcatgataagatttttgtcaccatg
ctgagatacaatggcgtaccttcctctttgaacgtgatatctaaaaaggtcggtgatggt
ggtcctcttctacaaccttatcccgattggtcgtttgctaaatatgacgattgctctgga
atcgtgagcgcctcaaaacttgcgatcgacaaatgcgacagattgtgggttctggactca
ggtcttgtcaataatactcaacccatgtgttctccaaaactgctcacctttgatctgact
acctcgcaattgctcaagcaagttgaaataccacatgatgttgccgtaaatgccactaca
ggaaagggaagattatcatctctagctgttcaatctttagattgcaatacaaatagcgat
actatggtgtacatagcagacgagaaaggtgaaggtttaatcgtgtatcataattctgat
gattccttccatcgattgacttccaacactttcgattacgatcctaaatttaccaaaatg
acgatcgatggagaaagttacacagcccaagatggaatttctggaatggctcttagtccc
atgactaacaatctctattacagtcctgtagcttccaccagtttgtattatgttaacacg
gaacaattcagaacatccgattatcaacagaatgacatacattacgaaggagtccaaaat
attttggatacccaatcgtccgctaaagtagtatcaaagagtggcgttctcttcttcgga
ttggtgggcgattcagctcttggctgctggaacgaacatcgaacacttgaaagacacaat
atccgtaccgtcgctcaaagtgatgagactcttcaaatgatcgctagcatgaagattaag
gaagctctnccacacgtgcctatattcgataggtatataaaccgtgaatacatattggtt
ttaagtaacaaaatgcaaaaaatggtgaataatgacttcaacttcgacgatgttaacttc
agaattatgaacgcgaatgtaaacgaattgatattgaacactcgttgcgaaaatcccgat
aatgatcgaacacctttcaaaatttcaatccatttgtaa

DBGET integrated database retrieval system