KEGG   Apis mellifera (honey bee): 406090
Entry
406090            CDS       T01057                                 

Gene name
Mrjp1
Definition
(RefSeq) major royal jelly protein 1 precursor
Organism
ame  Apis mellifera (honey bee)
SSDB
Motif
Pfam: MRJP
Other DBs
NCBI-GeneID: 406090
NCBI-ProteinID: NP_001011579
BEEBASE: GB55205
UniProt: O18330
Structure
PDB: 
5YYL

AA seq 432 aa
MTRLFMLVCLGIVCQGTTGNILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYD
YKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSG
IVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATT
GKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKM
TIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQN
ILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIK
EALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCENPD
NDRTPFKISIHL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgacaagattgtttatgctggtatgccttggcatagtttgtcaaggtacgacaggcaac
attcttcgaggagagtctttaaacaaatcattacccatccttcacgaatggaaattcttt
gattatgatttcggtagcgatgaaagaagacaagatgcaattctatctggcgaatacgac
tacaagaataattatccatccgacattgaccaatggcatgataagatttttgtcaccatg
ctgagatacaatggcgtaccttcctctttgaacgtgatatctaaaaaggtcggtgatggt
ggtcctcttctacaaccttatcccgattggtcgtttgctaaatatgacgattgctctgga
atcgtgagcgcctcaaaacttgcgatcgacaaatgcgacagattgtgggttctggactca
ggtcttgtcaataatactcaacccatgtgttctccaaaactgctcacctttgatctgact
acctcgcaattgctcaagcaagttgaaataccacatgatgttgccgtaaatgccactaca
ggaaagggaagattatcatctctagctgttcaatctttagattgcaatacaaatagcgat
actatggtgtacatagcagacgagaaaggtgaaggtttaatcgtgtatcataattctgat
gattccttccatcgattgacttccaacactttcgattacgatcctaaatttaccaaaatg
acgatcgatggagaaagttacacagcccaagatggaatttctggaatggctcttagtccc
atgactaacaatctctattacagtcctgtagcttccaccagtttgtattatgttaacacg
gaacaattcagaacatccgattatcaacagaatgacatacattacgaaggagtccaaaat
attttggatacccaatcgtccgctaaagtagtatcaaagagtggcgttctcttcttcgga
ttggtgggcgattcagctcttggctgctggaacgaacatcgaacacttgaaagacacaat
atccgtaccgtcgctcaaagtgatgagactcttcaaatgatcgctagcatgaagattaag
gaagctctnccacacgtgcctatattcgataggtatataaaccgtgaatacatattggtt
ttaagtaacaaaatgcaaaaaatggtgaataatgacttcaacttcgacgatgttaacttc
agaattatgaacgcgaatgtaaacgaattgatattgaacactcgttgcgaaaatcccgat
aatgatcgaacacctttcaaaatttcaatccatttgtaa

DBGET integrated database retrieval system