KEGG   Apis mellifera (honey bee): 408325
Entry
408325            CDS       T01057                                 

Symbol
Cdk5
Name
(RefSeq) cyclin-dependent kinase 5
  KO
K02090  cyclin-dependent kinase 5 [EC:2.7.11.22]
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ame01001]
    408325 (Cdk5)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ame04131]
    408325 (Cdk5)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     408325 (Cdk5)
Protein kinases [BR:ame01001]
 Serine/threonine kinases: CMGC group
  CDK family
   408325 (Cdk5)
Membrane trafficking [BR:ame04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    408325 (Cdk5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Haspin_kinase Kinase-like Seadorna_VP7 APH
Other DBs
NCBI-GeneID: 408325
NCBI-ProteinID: NP_001161897
BEEBASE: GB43092
UniProt: A0A7M6URT9
Position
LG11:complement(16166907..16169025)
AA seq 299 aa
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDEDDEGVPSSALREICLLKELKH
KNVVRLYDVLHSDKKLTLVFEHCDQDLKKYFDSLNGEIDLDVVKSFLYQLLRGLAFCHSR
NVLHRDLKPQNLLINKNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYT
TSIDMWSAGCIFAELANAGRPLFPGSDVDDQLKRIFKMLGTPTEETWPDFTTLPDYKPFP
LYHPAQGLAQVTPKLNSRGRDLLQRLLVCNPALRLSADEAMAHPYFNDLNPAIKNDRCQ
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcaaaaatatgagaaactcgagaaaataggagaaggtacttatggaaccgttttcaaa
gccaagaatcgcgagacccacgaaatcgttgctttaaaaagagttcgactagacgaagac
gatgaaggtgtaccgtcgtccgcactcagagagatttgtttactaaaagaattgaaacac
aaaaatgtagtaagattgtatgatgtgttgcatagtgataaaaaattaaccttggttttt
gaacattgtgatcaagatctgaagaaatattttgacagtttaaacggagagatcgatttg
gatgtcgtcaaatcctttttatatcaattattacgaggattggcgttttgtcacagtaga
aatgtattacacagagatcttaaaccacaaaatttacttattaacaagaatggcgagttg
aagttggccgattttggactagcaagagcttttggaattcccgtaaaatgttattcagcg
gaagttgtaacgttatggtaccgtccgccagatgttctttttggagcgaaattgtacaca
acatccattgacatgtggagtgccggatgtatatttgctgaactagcaaacgccggtaga
ccattgttccccggttcggatgtggacgatcaattgaagagaatatttaagatgttaggc
acaccgaccgaagaaacgtggccagattttacaactcttccagattacaaacctttccca
ctttatcatcccgctcaaggattggctcaagttacgccaaaacttaattccagaggcaga
gatttattgcagaggttgttggtatgtaatccagcgttacgattgtcagcggacgaggca
atggctcatccctatttcaacgacttgaaccctgccattaaaaacgatcgttgtcagtag

DBGET integrated database retrieval system