KEGG   Apis mellifera (honey bee): 408397
Entry
408397            CDS       T01057                                 

Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 11
  KO
K03036  26S proteasome regulatory subunit N6
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03050  Proteasome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    408397
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ame03051]
    408397
Proteasome [BR:ame03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     408397
SSDB
Motif
Pfam: RPN6_N PCI RPN6_C_helix Tox-ODYAM1 Lin0512_fam PEP-utilisers_N Lar_N
Other DBs
NCBI-GeneID: 408397
NCBI-ProteinID: XP_006557879
BEEBASE: GB54747
UniProt: A0A7M7GJD5
Position
LG13:complement(2490772..2492953)
AA seq 423 aa
MAGAMLFERAQAVSMTNRSEGISLLNEIVSDPSIGVTEDDEDNIRVKEQGILHLGELYKK
EGKAKELAELIKATRPFLSLISKAKAAKLVRSLVDFFLDLEAGIGIEVQLCKECIEWAKE
ERRTFLRQSLEARLIALYFDTGMYSEALQLGSALLKELKKLDDKQLLVEVQLLESKTYHA
LSNLAKARAALTSARTTANAIYCPPKMQAALDLQSGILHAADERDFKTAYSYFYEAFEGY
DSVESPKALTALKYMLLSKIMLRTPEDVQSIMSGKLAVKYAGKDLDAMRAVAEASHRRSL
ADFQTAVKKYREELEDDVIVRAHLGSLYDAMLEQNLCRLVEPYSRVQVSHIATCISLPLT
QVEKKLSQMILDKKLRGVLDQGEGVLIVFEDTPRDKTYEIALDTIHSMGKVVDTLYQKAK
KLT
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggccggtgcaatgttattcgaacgtgcacaagcagtttcaatgacgaatcgtagtgaa
ggtatttcacttttaaatgaaatcgtctctgatccaagtattggtgttacggaagatgac
gaggataacattcgtgtgaaagaacaaggtattttacatctcggtgaactttacaagaaa
gaaggcaaggcaaaagaactggcggaattaattaaggctaccagaccatttcttagctta
attagcaaagcaaaagctgctaaacttgtacgatccttagtagacttttttttggattta
gaagctggtattggcatcgaggttcaactatgcaaagaatgtatagaatgggcaaaagaa
gaacgtaggacatttttaaggcaatcattagaagcgcgtttaatagcattatattttgat
actggtatgtacagtgaagcgttacaattgggatcagctttacttaaagaacttaaaaaa
ttggatgataaacaactcttggttgaagtacagttattagaaagtaaaacctatcatgca
ttaagtaatttagcaaaagcaagagcagctcttaccagtgctagaacaactgctaatgca
atttattgtccacctaaaatgcaagctgctttagatttacaatcaggaattttacatgct
gccgatgaacgagattttaaaactgcatattcttacttttatgaagcatttgaaggatat
gacagtgtagaaagtccaaaagctttaacagctttaaaatatatgctactttcaaaaatt
atgttacgtacacctgaagatgttcaatcaattatgtcaggaaaattagctgttaagtat
gcaggaaaagatttagatgcaatgcgggcagttgccgaagctagccaccgacgatcattg
gcagattttcaaactgctgtgaaaaaatatcgtgaagaattagaagatgatgtaattgta
cgtgctcaccttggttccctttatgatgcaatgcttgaacaaaatttatgccgtttggtt
gaaccctattcacgtgtacaggtcagtcatattgcgacctgtatatcactgccacttaca
caagtggagaagaaactctcacaaatgatattggataaaaaattaaggggtgttcttgat
caaggcgaaggtgttttaattgttttcgaagacactcctcgtgataaaacttatgagatt
gcattagatactatacatagcatggggaaagtcgttgatacactttatcaaaaagcaaag
aaacttacttag

DBGET integrated database retrieval system