KEGG   Apis mellifera (honey bee): 408438Help
Entry
408438            CDS       T01057                                 

Gene name
IRS, InRS, chico
Definition
(RefSeq) insulin receptor substrate 1-B
  KO
K16172  insulin receptor substrate 1
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04068  FoxO signaling pathway
ame04140  Autophagy - animal
ame04150  mTOR signaling pathway
ame04213  Longevity regulating pathway - multiple species
Module
ame_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    408438 (IRS)
   04150 mTOR signaling pathway
    408438 (IRS)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    408438 (IRS)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    408438 (IRS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH
Motif
Other DBs
NCBI-GeneID: 408438
NCBI-ProteinID: XP_006565104
BEEBASE: GB49911
UniProt: A0A088AEM2
Position
LG13
AA seq 1219 aa AA seqDB search
MSSSRGLVSPSGGPVVLCGHVKKLKTQKKKYFVLRGEAPGYPACLEYYDSKKKFENRQPP
KRSILLDSCFNINRRVDTKHKHVIALYTKDECFCLILESEKELDEWLKAMLLLQSGDVAD
GEQPRPIFEHVWQVTMQKKGLGERKNIHGPYRLCLTDRTLSLVKIGAKDNSDSIEFPLIC
IRRCGYMDRIFYMEVGRSAVTGGGELWMEAEDNNIAHNMHAAIMNSMSNSSSSKDDVGPR
QRVRSSSATEASKPIFVLPHRYTGQRFYNSPLEEHRTHEEQVDPVQDQEQSNQTQSTSSC
NTITVVAGTGAGGTAGIASTNTNCATTARRRHSVASQPHSINNSQSVHVTTTSTTTTTTT
TITITMTATVTTTTTTATISHQRTLSLPLAAIINQMQSSKRSVLRCANGRDRCDSLPSRG
RTTSESHPTSIISHPRSSHFVSHVMRPHSMYVKGVSYSPPISSMPISPASGACSTDSAGS
SLSMDDGGENVLEEGTVSRYGHSLTPDEPVILEENGDDYAPWSTSHSHHKYSPNFKSHSP
SQQSSYLEMCSPCGSSPGPSGAYMPMSSGTGHSHSRGSSLVEESNTLPEGYVPMAPVGNN
GYVDMDPSHNHNGHFPDDLSHGGSSCSVTSGTPSTDLRFSEYHLDKVTSFLPPGDDLQAR
PARAYSIGSRPEPIKSHRKNRLDITQQDVSRVRAFSVGSRSKKPELGKLVNVVTAPLPVG
CENSSSNKSNSAPLLSSSWGHNSGCSITSERMEDLMELDFTKPSISTTFNSPPSSYSQPQ
SQSHSFSTATDTSSYVDMSPGQPPSSTTAPYVDMSRINKINRNNNNNTITANQNHSHIHV
SSSASIHKPVITTLKPVEEAEGPYMRMDGIMEDWSQSGSSPKLISSPMQEESVQSNGPPG
ATRTAPVDLPRRPPADYVDMNFKPRTSLEQDYINMNMSNRNNRKPMATRTGSRKEKSRSQ
PIAIQAGNKPIKTPSFLPLNGSPESESLASTPASPPRATPTGSSATIFPFSLNSPQSPEK
SFTHQKNTDELKPSELNMNLKHNNDRTIADATNGRVSTINSISVTDANSSTLSKVMIKDR
ASSPTGKDNQVNRIISNNSLTSQDNTLNNVTKKFSDLNVSKPRLITASPNTSPTLSGFKP
TIEKQPSSPKLPDETPTPTPTAMPSPLEKENFDKVQAAAEILHYASLDLPEVGNAAPMSP
ASQEGFNYAKIDFAKLKQN
NT seq 3660 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgagcaggggtttagtctccccttcaggaggtcccgttgttctctgcggtcac
gtgaagaaactaaagactcaaaagaaaaagtactttgtactgcgtggcgaagcaccagga
tatccagcatgtcttgaatattatgatagtaaaaagaaatttgaaaacagacaaccaccg
aaacgtagcattttattggacagttgctttaatattaatagacgcgtagatactaaacac
aaacatgttattgcattatatacgaaagatgaatgcttttgcttaattctggagagtgaa
aaagaactggatgaatggttaaaagcgatgcttttacttcagagcggagatgtagctgat
ggagagcaacctcggcctatatttgaacacgtatggcaagttacaatgcaaaaaaaggga
ttaggtgaacgaaagaatattcatggtccctatagactatgtttaactgatagaacatta
agcctagtaaaaattggagcaaaggataattcagattctatagaatttcctctaatttgc
atcagaagatgtggatatatggatcgtattttctatatggaagtaggtcgttcagcagtc
actggtggtggtgaattgtggatggaagctgaagacaacaatattgcacataatatgcat
gctgctattatgaattctatgagcaattctagtagcagtaaagatgatgtgggaccacgt
caaagagtgcgtagttcttctgctactgaagctagcaagccaatttttgtattaccacat
cgatatactggacaaagattctataattcaccattagaggaacacaggacgcacgaggag
caggtggacccagttcaagatcaagagcagtctaatcagactcagagtacctcttcttgc
aatacaatcacggtcgttgctggtaccggggctggtgggactgctgggattgcctcgact
aataccaactgtgccactaccgctagacgtcgtcattcggtagcgagtcaaccccattcc
atcaataattcccaatccgttcatgttacaacaacaagtacaactacaacaactaccact
actattaccatcactatgaccgctaccgtgaccaccacaaccacaaccgcgacaatatcc
catcagagaaccttgtcgctgcccttagctgccattatcaatcaaatgcaatcatctaaa
agatcagttttacgctgtgcaaatgggcgtgacagatgtgacagcttgccatcgaggggt
cgtactaccagcgaaagtcatccaacatcgataataagccatcctaggagttctcatttt
gtttctcatgtgatgagaccgcattctatgtacgtgaaaggcgtttcctattcaccgcca
atctcttcgatgcctattagtcctgcttccggtgcgtgttccacggattctgcaggatcc
tctctttcaatggatgatggtggtgaaaatgtgttggaagagggtactgtttcaagatat
ggacattctttgacgcctgacgaacctgttattctggaggaaaatggcgacgattatgct
ccgtggtccacatcacattcgcatcataaatattcaccaaattttaaatctcattctcct
tcccagcaaagttcctatttagaaatgtgtagtccttgtggatcgagtcctggcccaagt
ggagcttacatgccaatgagttcaggaacaggacactcgcattcacgaggatcttcactt
gtagaggagtcaaacactttaccagaaggttatgtacctatggcacccgttggaaataat
ggatacgttgacatggatccttcgcataatcacaatggtcattttcccgatgatctgtcg
catggtggcagtagttgttccgtcacttctggtacacctagcacagatttacgcttttcc
gagtatcatctagataaagtaacaagttttcttccacctggagacgatttgcaagcgaga
ccagcaagagcctattccattggttctcgaccagaacctataaaaagtcatcgtaagaat
agattggatattactcagcaagacgttagtagagtacgagcattctctgtaggtagcaga
tccaaaaaacctgaactcgggaaattagtgaatgtagttactgcaccattaccagttggt
tgtgaaaactcgagttccaataaatcgaactctgcaccgttattatcgagttcttggggt
cataattccggttgttctataacttctgaaagaatggaggatctaatggaattggacttt
acgaaacccagtatttctacaacctttaattcacccccttcatcttattcacaaccgcaa
tctcagtcacattcgttctctactgccactgacaccagttcctatgttgatatgtctcct
ggacaaccaccctcgtcgaccactgccccatacgtggatatgagccgcataaataagatt
aatcgtaataacaataataatacaatcactgccaatcaaaatcatagtcacattcatgta
tcgtcctctgcttccatacataaacccgtaattactacattgaagccggtggaagaagca
gaaggaccatacatgagaatggatggtataatggaggattggtcacaatccggtagtagc
cctaagttaatttcatcgcctatgcaagaagaaagtgtgcaatcgaatggaccgccagga
gccacgagaacagcaccggtcgatcttccacggcgtccacctgccgactatgttgatatg
aatttcaagccgagaacaagtttagaacaagattacataaatatgaacatgagcaatcga
aacaatcgtaaaccaatggcaacgcgaaccggtagtcgtaaagagaagtcacgttcgcag
ccaattgcgatccaagcgggaaacaaacctataaaaacgcctagtttcttacctttaaac
ggaagtccggaatcggaaagtttagcgagtacacccgcatctcctccccgagcaactccg
acaggttcctcggcgactattttccctttctccttgaacagtcctcaatcgcccgagaaa
tcatttacgcatcaaaagaataccgatgaactgaaaccatcagaactgaatatgaacctt
aaacataataacgatcgtactattgcagatgctacgaatggtagagttagcacgatcaat
tctatttctgtaacagatgcaaatagtagtactttgtcgaaagtaatgattaaagataga
gcatctagtcctacagggaaggataatcaagttaatcgcataatatcaaacaactcgttg
acctcgcaagataatacattgaacaatgtaacaaaaaagttttctgatttaaacgtatcg
aagccacgtttgatcactgcgtccccgaacaccagccccacgttatccggctttaagcca
actattgaaaaacaaccatcgtcccctaaattgccagatgaaacaccaacacctacacct
accgcgatgccaagtccattagaaaaagagaattttgataaagtgcaagctgctgcggaa
attttgcactatgctagtctagatcttcctgaagttggtaatgcggcacctatgtcgcca
gcatcccaagaaggcttcaattacgctaaaatcgatttcgctaaacttaagcaaaactaa

DBGET integrated database retrieval system