KEGG   Apis mellifera (honey bee): 408615
Entry
408615            CDS       T01057                                 

Definition
(RefSeq) nuclear transcription factor Y subunit gamma
  KO
K08066  nuclear transcription factor Y, gamma
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ame03000]
    408615
Transcription factors [BR:ame03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    408615
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF CENP-X
Other DBs
NCBI-GeneID: 408615
NCBI-ProteinID: XP_392156
BEEBASE: GB54831
UniProt: A0A088AT10
AA seq 346 aa
MSVFFVNANQDSEVEGDSNGDLQIASPGSSEAQQTLAQFWPKVTEEIKKITTMDLKTQSL
PLARIKKIMKLDDDVKMISAEAPMLFSKAAEIFIHELTLRAWVHTEDNKRRTLQRNDIAM
AITKYDQFDFLIDIVPRDELKQSKAQTESTVRTSMNSDQVHYYFQLAQQQASANQNVQSG
NATTQPIQIVQPSTGQIQTINIGSPVEQESTTPNTAQTVTVQSPQQSSGQQIIQLQQAQQ
TPTTQTGGIQIVQQIVTPSGEIQQIPIQLTPQQLQMIRMQVQGGSNQPIIIQTAPIQAQP
QLIQVAQGAQAPVFLQTSGTDNDSTNIFIATKSNGRMSALSRKTKR
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgtcggtattcttcgtgaatgctaatcaagatagtgaagttgaaggtgattcaaatgga
gacttacaaattgcatctcctggcagttctgaagctcaacaaactttggcacaattttgg
ccaaaagttacagaagaaattaaaaaaattactactatggacttaaaaacacaatcattg
ccattagcaaggataaaaaaaattatgaaacttgatgatgatgttaaaatgataagtgca
gaagctccaatgttattctctaaagcagcagaaatttttatacatgaattaacattaaga
gcatgggttcatacagaagataataaaagacgtactcttcaaagaaatgatatagcaatg
gcaataactaagtatgatcaatttgattttctaattgatatagtccctagagatgaattg
aaacagagtaaagcacagactgaaagcactgtacgtacttctatgaattcagatcaggta
cattactactttcaattagcacaacaacaagcttctgccaatcaaaatgtccaaagtggt
aatgctactacacaacctatacaaatagtacaaccgtcaactggacaaatacaaacaatt
aatattggtagtcctgtagaacaggaaagcactactccaaatacagcacagactgtaaca
gtacaaagtccacaacaatcatcaggccaacaaattatacaattacaacaggctcaacaa
acacctacaacacaaactggaggaatacaaattgtacaacaaattgtaacacctagtgga
gaaattcaacaaataccaatacaattaacgcctcaacaacttcaaatgattcgtatgcaa
gtacaaggtggaagtaatcaaccaattataattcaaactgctcctatacaagctcaaccc
caattgatacaggttgcgcaaggtgctcaagcaccggtgtttctacaaactagcggaaca
gacaatgactccacgaatattttcatcgcaacgaagagtaacggaaggatgagtgcccta
agcaggaagactaagagatga

DBGET integrated database retrieval system