KEGG   Apis mellifera (honey bee): 408626
Entry
408626            CDS       T01057                                 
Name
(RefSeq) poly(A)-specific ribonuclease PARN isoform X1
  KO
K01148  poly(A)-specific ribonuclease [EC:3.1.13.4]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    408626
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ame03019]
    408626
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     408626
Messenger RNA biogenesis [BR:ame03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     408626
SSDB
Motif
Pfam: CAF1 RNA_bind
Other DBs
NCBI-GeneID: 408626
NCBI-ProteinID: XP_006557413
BEEBASE: GB42161
UniProt: A0A8B6YTP8 A0A7M7GIJ1
Position
LG1:1154365..1171005
AA seq 576 aa
MEVTSSNFQEVLVELDEILKNATFLCIDGEFTGLNSGPDGGVFDTPAQYYAKLRTGSMDF
LLIQFGLSVFTFNKEMQKYNQRSYNFYVFPRPLNRMAPDCRFMCQTSSISFLASQGFDFN
KLFKLGIPYLTTNEEEKLMKRLEEKQRIRDEGTEILPISDVERPQIEEICSRIDEFVTSE
TEELLIEKCNAFIRRLVYQEVKLRWPNKLKVESKMNNFGCILVVQRLGTKEEEEQREIEK
REREKTEIQQAVGLSILMRKIADSGKLIVGHNMLLDLCHIVHQFFGQLPESYFEFKSLVH
SLFPRILDTKIICHSQQFKENIPSSNLGILLETVSKSPFKITEVEPIDGRSYSTLSEKCH
EAGYDAYITGICFIALSNYLGSLQKPEVPIVLSDSPLLNPFLNKLLIARLKDVPYINLVG
DDPNPSRDHVFHLTFPKEWKFNDISHLFSPFGSVHVSWLSDISAYIELHRRDQVNEVMKV
LAKTSTYKLQRYADYQASLENFNTGERKRKLSSSEAVSTLKKGEKSVATNGVKNPQDDDS
WEVATGKRRRKRRNYADAENAQRSKQKPFVEPDSWE
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggaagtgacttcttcgaattttcaagaggtcctagtggaattagatgaaattttgaag
aatgcaacatttctttgtatcgatggagaatttacaggacttaattcaggacctgatggc
ggtgtctttgatacacctgctcagtattatgcaaaattaagaacaggatcaatggatttc
cttcttatacaatttggcctttctgtctttacatttaataaagaaatgcaaaagtataat
caacgatcctataatttttatgtttttccacgtccgttaaatcgtatggctccagactgc
agattcatgtgtcaaacttccagtatatcatttctagcgtcacaaggattcgattttaat
aaacttttcaaattgggcattccttatttaactacaaatgaagaagaaaaattgatgaaa
cgattagaggagaaacagaggataagagatgaaggaacagaaatattgcctatttcggac
gtcgagagacctcagattgaagagatttgttcgaggatagatgaatttgtcacttccgaa
acagaagaactattgatagaaaaatgtaatgctttcattagacgactcgtgtatcaggaa
gtaaaactaagatggccaaacaaattaaaagttgaaagtaaaatgaacaattttggatgc
attcttgtagtacaaagattaggaactaaggaagaagaagaacaaagagagattgagaaa
agagaaagagaaaaaacagaaattcaacaagcagttggattaagtattcttatgaggaaa
attgcagattccggaaaattaatagtcggtcataatatgttattagatctctgtcatata
gtacatcaattttttggacaattaccggaatcatattttgagtttaagagtcttgttcat
agtctatttccaagaattttagatacaaaaataatttgccattcgcagcaatttaaggaa
aatataccatcgtcgaatttaggtatattactagaaactgttagtaaatcaccgtttaaa
attacagaagtggaacctatcgatggtagaagttattctacattatcagaaaaatgtcac
gaggctggttacgatgcatatataactggaatatgtttcattgcattgtccaattatctt
ggttccttacaaaaacctgaagtgccgatagttttatcggattcacctttactcaatcct
tttttaaataaacttctcatagcaagattaaaagatgtgccgtatataaatcttgttgga
gatgatcctaacccaagtagagatcatgtattccatttaacattcccaaaagagtggaaa
tttaatgacatatctcacttgtttagtccatttggaagtgtgcatgtgtcatggttaagt
gatatatccgcatacatagaattacatcgtcgggatcaagtcaacgaggtgatgaaagtt
ctagctaaaacgagtacctataaattacaaaggtatgccgattaccaagcttctttagaa
aacttcaatacaggagagcgtaaacgaaaattatcttcgtccgaggcagtgtccacgttg
aaaaagggtgagaaatcggtggcaacgaacggcgtgaagaaccctcaggacgacgatagc
tgggaagtagccacagggaaacgacgccggaagcggaggaactatgcggatgcagagaat
gcgcaaagatcgaaacagaaaccctttgtcgagcctgattcctgggaataa

DBGET integrated database retrieval system