KEGG   Apis mellifera (honey bee): 408680
Entry
408680            CDS       T01057                                 

Name
(RefSeq) ryanodine receptor isoform X1
  KO
K04962  ryanodine receptor 2
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ame04040]
    408680
   04990 Domain-containing proteins not elsewhere classified [BR:ame04990]
    408680
Ion channels [BR:ame04040]
 Voltage-gated cation channels
  Ryanodine receptor
   408680
Domain-containing proteins not elsewhere classified [BR:ame04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   408680
SSDB
Motif
Pfam: RYDR_ITPR RyR SPRY Ins145_P3_rec RR_TM4-6 MIR RIH_assoc Ion_trans EF-hand_7 GWT1 Serglycin DASH_Spc34
Other DBs
NCBI-GeneID: 408680
NCBI-ProteinID: XP_006569098
BEEBASE: GB55650
UniProt: A0A7M7GWS7
Position
LG2:complement(12739735..12773483)
AA seq 5142 aa
MADSEGGSEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDLS
QCVFVIEQALSVRALQELVTAAGSETQQENLGKGTGSGHRTLLYGNAILLRHQNSDMYLA
CLSTSSSNDKLAFDVGLQQHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYL
HTTKENDLSVVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTW
STAPSQNIVIYEGGSVMSQARSLWRLELARTKWAGGFINWLHPMRIRHLTTGRYLGVKEN
NELYLVDRNEATIETSTFSLRQEKDDQKIVLEDKDLEVIGTPIIKYGDSTVIMQHATTCL
WVSYKSYETKKKGVGKVEEKQAVLHEEGKMDDGLVFSRSQEEESRTARVIRKCSSLFTQF
ITGLETLQVDRRASMFFQNVNLNEMVMCLEDLINYFAQPEDDMEHEEKQNKFRALRNRQD
LFQEEGILNLILEAIDKINVITSQGFLVALSGDESGQAWDQISGYLYQLLAAIIKGNHTN
CAQFANSNRLNWLFSRLGSQASSEGTGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEK
HGRDPKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTQLVDHVASVRPNIFVGR
VENSAVYQKWYFEVTVDHIEQTTHMMPHLRIGWANTSGYMPYPGGGEKWGGNGVGDDLYS
FGFDGAYLWTGGRKTQVVHNVTEPYIRKSDVIGCALDLTIPIITFTFNGAPITGSFRNFN
LDGMFFPAISCSSKLSCRFLLGGDHGRLKFQPPEEFSPLVESLLPQQILSLDPCFYFGNM
NKVVLAGPWLVEDDTAFVPGPVDTSMINLPSYVEQIRDKLAENIHEMWAMNKIEAGWMYG
EHRDDMRKIHPCIVQFERLPAAEKRYDTQLAVQTLKTILALGYYITIDKPPSRIKTLRLP
NEPFLQSSGYKPAPLDLTAITLTPKMEELVDQLAENTHNLWAKERISQGWTYGLNEDSEM
RRSPHLVPYPKVDEAIKKANRDTASETVRTLLVYGYMLEPPTGEQHEALLLEASRLRQLS
FRTYRVEKHYAVSNGKWYFEFEVLTAGPMRVGWAKADCMPGSMLGSDENTWAFDGYNVTK
VHAGTHESFGHKYQVGDIVGCFIDVADRTISFSLNGELLMDALGGETSFADVQGDCFVPA
FTLGVGQKAKLTFGQDVNTLKFFTTCGLQEGYEPFCVNMNRPVTFWYTKDQPIFENTDDM
ADTRIDVARIPAGSDTPPCLKISHNTFETMEKANWEFLRLSLPVICQSIFISESEKLRRW
QEIKMRQNKLLSEQMEQAQQVPSAHIEQIMKSGFSMSDIKGLQRNYSEDAVEADEMMKES
PIPMQRNKPARPPRKGSLYGSRTGNMENAISEADMNGYGDMNGDIKDDKKKRGRSPFRFF
SRKAKSPDAKSKTPEPPIRSDVSDKSTKTLSMNKASSRPPQIRISNTDLKVVPPQIPERN
APKAMSVLTGSGVEAIGNEIFDTECLKLMNEYFYGVRIFPGQDPTHVYVGWVTSQYHLHT
KDFNLSRVRKGSVVITDDYDRPVEQVDRQSCYMVRADELYNEVTQDASGKGASQGMFVGC
FVDTATGWVSFTCEGKETSHKFKMEPDTKLFPAIFVEATSKEILQIELGRTSTTLPLSAA
VLQNSERHVIPQFPPRLKVQCLKPHQWARVPNQSLQVHALKLSDIRGWSMLCEDAISMLA
LHIPEEDRCIDILELIEMDKLLSFHAHTLTLYAALCYQSNYRAAHALCQHVDQKQLLYAI
RAEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYIIPLGQELKELYENEEMKHSLRYL
ETESVRPQMKMTDIRDDSSSDQAIENIRSLYSPHFPLDVVRDYVMTALNEAVEINQVHNR
DPIGGSNENLFLPLLKLVDRLLLVGMLRNEDIMKLLIMIHPETWDPTFEKEGKDEHKKGL
LHMKMAEGAKLQMCYLLHHLNDIQLRHRVESIIAFSHDFVGDLQSDQLRRYIEIKQSDLP
SAVAAKKTREFRCPPREQMNAILSFKNMEFEDDPENIPCGEELISKMNEFHNNLMSYVSL
HALQEAADALEESIEEVQKPGAIKRLFNFINAVKELEEEPKPEPEPEKKTPEEVFRKVLI
KTIVSWAEESQIETPKLVREMFSLLVRQYDTVGELIRALEKTYVINSKTKDDVALMWVGL
SQIRALLPVQMSQEEEELVRERLWKLVNNHTFFQHPDLIRVLRIHENVMAIMMNTLGRRA
QAQSDAQTQPQTTEGEPVSKEKDTSHEMVVACCRFLCYFCRTSRQNQKAMFDHFDFLLEN
SNILLSRPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAIYLSRCGLQSNSELVEKG
YPDLGWDPVEGERYLDFLRFCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLLR
AIIDANKMSEKIADRRKVHDEAEGSTVMQFEHPLPESDDDEDYIDTGAAILNFYCTLVDL
LGRCAPDSSVIEQEASTESVGKNESLRARAILRSLVPLDDLQGVLSLRFTLLNPAAGEEK
PKSDMPSGLIPGHKQSIVLFLERVYGIETRELFFKILEEAFLPDLRAATMLDRNDGYESD
MALAMNRYIGNSILPLLIKHSKFYNEADNYASLLDATLHTVYRLSKNRMLTKGQREAVSD
FLVALTREVHELNVSQMQPSMLLKLLRKLTVDVSKLSEYTTVALRLLTLHYDRCAKYYGS
TGGQGAYGASSDEEKRLTMVLFSNIFDSLSKMDYDPELFGKALPCLTAIGCALPPDYSLS
KNYDDEWYGSKSASAQSPDGPYNPQPINTSSVVLNNDLNQIVQKFSEHYHDAWASRKLEN
GWTYGEQWSDMNKTHPRLKPYNMLNDYERERYKEPVRESLKALLAIGWSVEHAEVDVPST
NRSSMRRSSKSQGDSANPFNYNPHPVDMTNLTLSREMQNMAERLADNAHDIWAKKKKEEL
ITCGGGIHPQLVPYDLLTDKEKRKDRERSQEFLKYLQYQGYKLHKPNRGGESEVATAGAS
VELRFAYSLLEKLIAYLDKATINMKLLKPSDTFSRRNSFKTSTRDIKFFSKVVLPLMEKY
FSTHKNYFIAVATATNNVGAASLKEKEMVAALFCKLASLLRSRLAAFGPDVRITVRCLQV
LVKGIDAKSLVKNCPEFIRTSMLTFFNNTADDLGHTILNLQEGKYSHLRGTHLKTSTSLS
YINSVVLPVLTAMFDHLAACEYGSDLLLDEIQVASYKMLASLYTLGVDATLTHDRKYLKT
EIERHKPNLGSCLGAFSSCFPVAFLEPHLNKHNQYSLLNRIADHSLEAQDIMTKMESSMP
TLETILTEVDQFVESEKTYNEVPHVVDVILPLLCSYLPFWWAQGPDNVNPTEGTYVSMVT
SDHMNQLLKNVLKLIKKNIGNENAPWMTRIAAYTQQIIINSSEELLKDPFLPLAERVRKR
TDTMFHKEESLRGFIKSSTDDTSQVEAQIQEDWQLLVRDIYSFYPLLIKYVDLQRNHWLR
NNISEAEDLYNHVAAIFNIWSKSQYFLREEQNFISANEIDNMVLIMPTATRRPAAISDGT
APSGGGKKKKKHRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRFLK
KMPEYEIAEFAKTQLTLPDKIDPADEMSWQHYLYSKLGQKKDSMEPVKAQQLEDVVARIT
DMAKVLYGLHMIDHPQQQSKGQYRSVVSIQRKRAVIACFRQTSLHSLPRHRAINIFARTY
YELWLQDENVGQEVMIEDLTQSFEDAELKKMDKDEDEGKPDPLTQLVTTFCRGAMTERSG
ALQEDPLYMSYAQIISKSCGEEEEEGEDEGGGGEEEGGASIHKRGHKPLMRPMHKLMEQE
MEKQKLLFHQARLANRGVAEMVLLHISACKGVPSEMVMKTLELGISILRGGNIEIQRGML
NHLKEKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGSEGAAGEKNMHDAEFTCA
LFRFIQLTCEGHNLDWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKELI
DPAGKANFFKAIGVASQVFNTLTEVIQGPCAQNQQALAHSRLWDAVGGFLFLFSHMQDKL
SKHSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESAGNVELILKYFD
MFLKLKDLVSSPSFLEVDLNSDGWVYPKDFKEKMEQQKSYTDEEIEFLLACCETNHDGKI
DYVAFMDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPYLGRIEI
LGGNKKIERVYFEIKESNIEQWEKPQIKESKRTYFYNTVVEAGEKEKLETFINFCEDAIF
EMQHASALMAVEESGGIGKARESSYTYMTDDDEERNKDPIRRGIQTFKDSIYFFFSIFSP
SNIKNKIAEMQQMTFLELFIGFFKMIFYAFYYSGFGVGCVIGYFMKLLLALMKGPHVEEP
VVEVKEEEEKPSRHLPALPPTPDESNLQVQAFGMDITKEEGGQIKIAPHESATSTPQSSI
EETGESTPEEATGEESARAEGGGDMESPVSLADLLGGEQARAQAAAAAEAAAAQQAAMAA
VEAEAKQETIAEPSASSIDFSEYTHRVVSFLARNFYNLKYVALVLAFCINFMLLFYKVSS
LDSEGGEEGSGQIVDMLAEMSGEGASGSGNGSGVEIGSGSGEAESEEEEDEYALEYVEVA
EDFYYMAHVIRLMAILHAIVSLAMLVAYYHLKVPLAIFKREKEIARRVEFDGLYIAETPE
EDDIKAHWDKMVISAKTFPVNYWDKFVKKKVRQKYSETYDFDYISNLLGMEKTSFSQQEE
EGSGLIHFIVNIDWRYQVWKAGVTITDNAFLYSLWYFTFSILGNYNNFFFAAHLLDVAVG
FKTLRTILQSVTHNGKQLVLTVMLLTIVVYIYTVIAFNFFRKFYIQEEDDEVDKKCHDML
TCFVFHLYKGVRAGGGIGDEIGEPDGDDYEVYRIMFDITFFFFVIVILLAIIQGLIIDAF
GELRDQLENVKTNMESNCFICGLGKEYFDTVPHGFDTHVQQEHNLANYMFFLMHLINKPD
TEYTGQETYVWNMYQQRCWDFFPVGDCFRKQNEAVEEEAKKK
NT seq 15429 nt   +upstreamnt  +downstreamnt
atggccgacagcgagggtggctccgagcaggatgacgtatccttccttcgcacggaggat
atggtatgtctgtcctgcacggcaaccggtgaaagagtttgcctggcagccgagggattt
ggtaatcgacactgtttcctcgagaatatcgcggataagaacataccgcccgacctgtcg
caatgcgtattcgtaatagagcaggctctctcggtacgagctttgcaggaattggtcact
gctgccggttccgagacgcagcaagaaaatttaggaaagggtacaggatccggacacaga
acgttgttgtacggtaacgcaattttactaaggcatcagaacagcgacatgtatttggct
tgtctatcgaccagctcgtccaacgacaagttggctttcgacgtgggcctccaacagcat
tctcaaggcgaggcttgttggtggacggttcatccagcatcgaagcaaaggtccgagggt
gagaaggttcgagtcggcgatgaccttatcctggtatccgtggccacagaaagatacttg
cacaccaccaaggagaacgatttgtcggtggtgaacgcctcgttccacgtgacccactgg
tccgtgcaaccgtacggaacaggaatcagccggatgaaatacgtcggttacgtatttggc
ggtgacgttcttcgattcttccacggtggcgacgaatgtctcaccataccatcaacatgg
agcacagcgccaagtcaaaatatagtgatctacgagggagggagcgtgatgagccaagca
agatctttatggaggttggagctggcgaggacgaagtgggcaggcggtttcatcaattgg
ttgcacccgatgagaatcagacacctgactacaggccggtatctcggcgtgaaagaaaac
aacgaattgtatctggtcgataggaacgaggccacgatcgagacctcgacgttctcgttg
cggcaagagaaggatgatcaaaagatcgttctcgaggacaaggatctcgaggttatcggt
acaccgatcatcaaatacggcgactcgaccgttatcatgcaacacgccaccacttgcctc
tgggtctcgtacaaatcgtacgagacgaagaagaagggagtgggcaaggtggaggagaag
caagccgtccttcacgaggaagggaaaatggacgacggtttggtcttctcccgttcgcaa
gaggaggagtctaggacagctcgagtgattaggaagtgcagcagtctgtttacccaattc
atcacaggcctagagacgctgcaagtggatagaagagcgtccatgttcttccaaaatgtg
aatctgaacgagatggtgatgtgtctggaagacttgatcaattactttgctcaacccgaa
gacgacatggaacacgaggagaaacagaacaaattccgagccctgagaaatcgccaagac
ctgttccaagaggaaggtatactgaatctgatcttggaagccatcgacaagatcaacgtg
atcacgtctcaaggttttctcgtcgctctttcgggtgacgagagcggtcaagcctgggac
caaatatccggatacctgtatcaactgttggcagcgataatcaaagggaatcacacgaat
tgcgcccaattcgccaacagcaatcgattgaactggttgttcagccgtttaggctcgcaa
gcttcgagcgaggggacggggatgttggacgtgcttcattgcgtcctcatcgactcgccc
gaggctttgaacatgatgagggacgagcacatcaaagtgatcatttccctgctcgagaaa
cacggaagggacccgaaagtgttggacgttctttgctcgctgtgcgtgggtaacggcgtc
gccgtccgatcgtcccagaacaacatctgcgatttcctgctgcccggcaagaatctactc
ctgcaaacccaactggtcgaccacgtggcgagcgtgaggccgaacatattcgtcggtaga
gtggaaaattcagctgtttaccaaaaatggtacttcgaagtcaccgtcgatcatatagag
cagactacgcacatgatgccgcacttgagaataggatgggccaacacttctgggtacatg
ccgtatcccggtggtggcgagaaatggggtggaaacggtgtcggcgacgatctctactcg
ttcgggtttgacggcgcctatctgtggacgggcggtagaaagacccaagttgtccacaac
gtgacggagccttacatcaggaaaagcgacgtgatcggttgcgcgttggatctcacgata
cccataatcacgttcaccttcaacggagcgcccattacaggatcgttccgaaatttcaac
ctggacggaatgttcttccccgccatcagctgctcgtccaaattatcctgcagattcctg
ttaggcggggaccacggccggctcaagttccaacctccggaagaattctcaccgttggtg
gagagcctgctaccccaacaaattttgtccctcgatccgtgcttctacttcgggaacatg
aacaaagtggtgctggccggcccctggctggtcgaggacgacacggctttcgtcccgggc
ccggtcgacacttccatgatcaatctgccgtcctacgtcgagcaaatcagggacaagctg
gccgagaacatccacgagatgtgggcgatgaacaaaatcgaggccggatggatgtacggg
gagcacagggacgacatgaggaagatacatccttgcatcgttcagttcgagagattgccg
gcggcggagaaacgttacgacactcaactggccgtccagactctcaagactattctggcg
ttgggctattacatcaccatagacaaaccgccgtcgaggataaaaactttgaggcttccg
aacgagcccttcctgcagagcagcggttacaagcccgctcctctcgatctcaccgcgatc
accctcacgcccaagatggaggagctggtcgaccaactcgcggagaacacccacaatttg
tgggcgaaggaaaggatcagccagggttggacgtacggcctgaacgaggactcggagatg
agaaggagcccgcatttggtcccctacccgaaggtggacgaggcgatcaagaaagccaat
cgtgacacagccagtgaaacggtgaggacgcttttggtctacggatacatgttggagccg
cctacaggggaacagcacgaagcgctgttgttggaggccagcaggttacgccaattgtcg
tttagaacttatcgcgttgagaagcattacgcggtgagcaatggaaagtggtacttcgag
ttcgaggttctgacggctggtccaatgcgagttggttgggcgaaggcggattgcatgccc
ggaagcatgctgggaagcgacgagaacacgtgggcattcgacggttacaacgtaactaaa
gtacacgccggtacccacgagtcatttggtcacaaatatcaagtgggcgacattgttgga
tgtttcattgacgtcgcggaccgaacgatcagcttttctctaaacggggaactgctgatg
gacgcgttgggcggcgagacttcgttcgccgacgtgcagggcgattgcttcgtgccagct
ttcactctcggcgtcggtcaaaaagcgaaattaacgtttggacaggacgtgaacaccctg
aaattcttcaccacctgcggcttgcaagagggatacgagccgttctgcgtaaacatgaat
cgaccggttacattctggtacaccaaggatcaaccgattttcgagaacacggacgacatg
gccgacacgaggatagacgtggccaggattccagcgggttccgacaccccgccatgtttg
aagatctcgcacaacacgttcgagacgatggagaaggcgaattgggaattccttcgactg
tcgttgccagttatctgtcaatcgatcttcatttcggagagcgagaagctgagaagatgg
caggagatcaagatgcgacagaacaaattgttgtccgagcagatggagcaagctcaacaa
gttccctccgctcacatagagcagatcatgaaatctggtttcagtatgagcgacatcaaa
ggattgcaaaggaactattcggaggatgcggtggaagccgacgaaatgatgaaagagtcg
ccgattcctatgcagaggaacaaaccggccaggcctccgaggaaaggttccctgtacgga
tcgaggactggaaacatggagaacgcgatcagcgaggccgacatgaatggatacggcgac
atgaacggcgatatcaaagacgataagaagaaacgtgggcgttcgccgttccgattcttc
tcgcggaaagcgaagtctccggatgcgaaatcgaaaacgcccgagccaccgatacgctcc
gacgtctctgacaaaagcacaaagacgctatcgatgaacaaagcaagtagccggcctccc
caaattcgtatatcaaacacggatttgaaagtggtgccgccccagatcccggaacgaaac
gcgcccaaagcaatgtccgttctgaccggaagcggcgtcgaggcgattgggaacgagata
ttcgatacggaatgcttgaaattgatgaacgaatacttctacggggtacgaatattccct
ggacaggatcccactcacgtttacgtaggatgggtgacctcgcagtaccatttgcacacc
aaggacttcaatctgtcccgcgtgaggaagggttccgtagttatcacggatgactacgat
cgtcctgtagagcaggttgacaggcaaagttgctacatggtgagagcggacgagctttac
aacgaagtgacgcaagacgcgtctggcaagggtgcgtctcaggggatgttcgtcggatgt
ttcgtggacacggcgaccggttgggtctcgttcacgtgcgagggaaaggagaccagtcac
aagttcaagatggaacccgacacgaaactattccccgccatcttcgtggaggccaccagt
aaagagatccttcaaatcgagctcggaagaacttccaccacgttgccactgtccgccgcg
gtgttgcagaactctgagcgtcacgtgataccgcagtttccgcccagattgaaggttcaa
tgtttgaagcctcaccaatgggccagagttcccaaccagtccctccaagtgcacgcgtta
aaattgtccgatatcaggggttggtccatgctatgcgaggacgccatatcgatgctggct
ttgcacattcccgaagaagataggtgtatcgatatcttggaactgatcgaaatggacaag
ctactcagctttcacgcgcacactctgacgctgtacgcggctctctgctaccaatcgaat
tacagagcagcgcacgctctgtgtcagcacgtcgatcagaaacaattgttgtacgcgatt
cgagcggaatacatgtccggacccctacgacaaggattctacgacttgctgatcgcgttg
cacctcgaatcgcacgcgactacgatggaagtgtgcaagaacgaatacattattccttta
ggtcaagaattgaaggaactgtacgaaaacgaagaaatgaaacacagtctcaggtatctg
gagaccgaatcggtccgacctcagatgaaaatgacggacatcagggatgattcttccagc
gaccaggcgatcgagaacataaggagcctgtacagcccgcacttccccctcgacgtggtg
cgggattacgtgatgacagctttgaacgaggccgtcgagatcaatcaagttcacaatcga
gatccgatcggaggcagcaatgagaatcttttcctaccacttttgaaacttgtagacagg
ttgctcttggttggaatgctcaggaacgaagacatcatgaagcttctgatcatgatccat
cccgagacttgggacccaacgtttgaaaaagagggaaaggacgagcacaagaagggattg
cttcacatgaaaatggccgagggagctaagctgcagatgtgctaccttctccatcatctg
aacgacatccagcttcgacatcgcgtcgagtccatcatcgcgttcagccacgacttcgtc
ggtgatctccaatccgatcaacttagacgttacatcgagatcaaacagtccgacttgcca
tcggcggtggcagccaagaagaccagagagtttaggtgtccgcctcgagaacagatgaac
gctatcttaagtttcaagaatatggaattcgaggatgatcccgagaatataccttgcggg
gaagagttgataagcaagatgaacgaattccacaacaatctcatgtcttacgtgtccttg
cacgctcttcaggaagcggcggatgctttggaggagtcaatagaagaagttcagaaacct
ggcgccattaagaggctgttcaattttatcaacgcggtgaaagagttggaggaggaacct
aaacctgaaccggaacctgaaaagaagactccagaagaggtattccgcaaagttcttata
aagactatcgtcagctgggccgaggaatctcagatcgagactccaaaattggttcgagaa
atgttcagtttgcttgtccgtcaatacgataccgtgggcgaattaattcgagccttggag
aagacttacgtgatcaacagcaagacgaaagacgacgttgctttgatgtgggtcggtttg
agccagatacgtgccctgttgcctgtccaaatgtcccaagaggaggaggaattggtcaga
gaacgactctggaaattggtgaacaatcacactttcttccagcatccagatctgatcaga
gtattgagaattcacgagaacgtgatggcgatcatgatgaatacgctgggcagacgtgcg
caggcgcagtccgacgctcaaacacaaccgcagacaaccgaaggagaaccagtttccaag
gagaaggatacttctcacgaaatggtggtggcatgctgtagattcctgtgctacttttgt
cgaacatcgaggcaaaatcagaaggcgatgttcgatcatttcgattttctcttagagaac
agcaatattttactgtcgaggccatcgttaagaggttcgacgccattggacgtggcatat
tcctctcttatggaaaacacggagcttgctttggcactgagagaacattacctcgaaaag
attgccatctacttgtctcgttgcggtttgcaatcgaattcggaattggttgagaaaggt
tatcctgatctgggttgggatccagtggaaggtgaacgatacttggacttcttgagattc
tgcgtttgggttaatggtgaaagtgtcgaggaaaatgcaaatttagtgatccgtctgctg
atcagaagaccagaatgcttgggtccagctcttcgtggtgaaggcgaaggtttattgaga
gccatcatagacgccaataagatgtccgaaaaaatcgcggatcgacgaaaagtacacgac
gaagcagagggttcaacggtcatgcaattcgaacatccacttccagaatcagacgacgac
gaagactatatcgacacgggagccgccatcttgaatttctattgtactttggtggaccta
ttaggccgctgcgctccagattcttccgttatcgaacaagaggcttctacagaatctgtc
ggaaagaacgaatctcttcgagcgagagccattcttcgatcgttggtgcctcttgatgat
ctacaaggtgtcttgtctttaagattcaccttactgaatccagcagcaggtgaagagaaa
ccaaagagcgatatgccgtctggtttgattcctggacacaagcagagcatcgttctgttt
ctggaacgcgtttacggcatcgaaactcgggaactgttcttcaaaatactcgaggaagct
ttcttgcctgatctcagagctgctactatgttggataggaacgatggatacgaatcagat
atggcgttagcgatgaatcgttatatcgggaacagtattctaccattattgatcaagcat
tccaagttctataacgaggctgacaattacgcgagtttattggacgccacgttacacact
gtataccgattgagcaagaacagaatgctgacaaagggtcaacgagaagcagtctcggat
ttcctcgtggcattgaccagagaagtccacgagttaaatgtctcccaaatgcagcctagt
atgctgttgaagctgcttcgaaaactgaccgtggatgtatccaagctatctgaatacacg
accgtcgctttaaggctgctgactttgcattacgatcgttgtgcaaaatattacggttca
accggcggacaaggtgcatacggtgcatcgagcgatgaagagaaacgtttgacaatggtt
ctgttcagcaacatattcgattcgttgtccaagatggattatgacccagaattgttcgga
aaagctctgccttgtctcacagctatcggttgcgcgttaccgcctgactattcgttatct
aaaaattacgatgacgagtggtacggaagtaaatctgcgtctgcacagtcgcccgatgga
ccatacaatcctcaacctatcaatacgtccagtgtggtgctgaacaatgatcttaatcag
atagtacagaaattctccgagcattatcacgatgcttgggccagcaggaagttagaaaat
ggttggacgtatggcgaacagtggtccgacatgaacaaaactcatccgagattaaagcct
tataacatgttaaacgattatgagagagaacgatacaaagagccagttagggagagttta
aaagctttgcttgctataggatggagcgttgaacacgcagaagtggatgtgccctctacg
aatcgtagctcgatgagaagatcatcgaaaagtcagggtgattcggcaaatccattcaat
tacaatcctcatccagttgatatgaccaacttgactttgagcagagaaatgcaaaatatg
gcggaacgtctggcggataatgcgcatgatatttgggcgaaaaagaagaaagaggaactt
atcacttgtggaggaggtatccatcctcagctggtcccgtacgatcttttgaccgacaag
gagaaacgaaaagaccgcgaacgttcccaagaattcctaaaatatttgcaatatcaaggt
tacaagcttcacaaaccgaatcgaggcggagaatcggaagttgcgacagctggtgcctcg
gtggagttgcgatttgcatactcgttgctagaaaagttgatagcctacttggacaaggct
accatcaatatgaaattgttgaaaccttcagacacgttcagccgtagaaacagtttcaag
acgtccacgagagacatcaaattcttcagcaaggtcgttcttccgttgatggaaaaatat
ttcagcacgcacaagaattacttcatcgctgtggccacggctaccaacaacgttggagct
gcgtctctgaaggagaaagagatggtcgcggctctgttttgcaaattggcaagtctattg
agatctagattggctgcgtttggaccagatgttaggatcactgtcagatgccttcaagta
ttagtcaaggggatagacgcgaagagtttggtgaagaattgtcccgagttcatcagaacg
tcaatgttgactttctttaataatactgcagatgatttaggacacacgattctgaattta
caagagggcaagtacagtcatctgaggggaacacatttgaagacttccacgtctttgtcg
tacatcaatagcgtagttctgccggttttaacagccatgttcgatcatttggctgcctgc
gagtatggtagcgatttgttactggacgagattcaggtagcatcctacaaaatgctggca
tctctttacaccttgggcgtagacgcgacgttgacgcacgacagaaagtatttgaagaca
gaaatcgagcgtcacaaaccgaatttaggctcttgcctaggtgctttctccagttgtttc
cccgtagcgtttttggagccccacttaaacaaacacaatcaatattctcttctgaatcgt
atcgccgatcactcgttggaagcgcaggatattatgacgaaaatggaatcgagcatgccc
accctcgaaacgattctgacggaggtcgatcaattcgtcgagtctgagaaaacttacaac
gaagttcctcacgtggtcgacgttattcttcctctactttgctcttatctgcccttctgg
tgggcccagggcccggacaacgtaaatccgaccgaaggaacgtatgtcagtatggttacc
agcgatcacatgaatcaattgctgaaaaatgtattaaaattgatcaagaagaacatcggt
aatgagaacgcaccttggatgactcgtatcgcggcttacactcaacagatcatcatcaat
tcgtcggaggagttgttgaaagatccgttcttaccgctcgctgaacgtgtcagaaagcgt
acagatactatgtttcacaaggaggaatctcttcgtggtttcatcaagtcgtcgacggat
gacacgtctcaagtcgaagcacagattcaagaagattggcaacttttggttcgtgacatc
tattccttctatcctcttttgatcaagtacgttgacttgcaaaggaatcattggttaagg
aataacatatcagaagcggaagatctttacaatcacgtggcagcgatatttaacatctgg
tcgaaatctcagtacttcttgagagaggagcagaactttatatctgcaaacgagatcgat
aatatggtgctcataatgcctactgcgaccaggagacctgccgccatctcggatggaact
gcaccttctggaggaggcaagaaaaagaagaaacatcgagacaagaagagggataaagac
aaagaggtgcaagcttctttgatggtagcatgtttgaaaagattactcccagttggtctc
aatttattcgccggtcgtgaacaagaattagtgcaacactgcaaggacagattcctgaag
aagatgccggaatacgaaatcgctgaattcgccaaaacccaattgactttaccggacaag
atcgatccagctgacgagatgtcgtggcaacactacttgtactccaagttgggccaaaag
aaggactccatggaaccagtgaaagcgcaacaactggaggatgtggttgcgaggatcaca
gacatggccaaagttctttatggtttacacatgatagatcatccgcaacagcagagcaag
ggtcaatatcgatccgtggtgtcgatacaacgtaaacgagcagtaattgcttgcttccgt
caaacttccctacattccttgcccaggcatcgggctataaatattttcgcgcgaacatat
tacgagctctggttgcaggatgaaaatgttggccaagaagtgatgattgaagacctaacg
caatcctttgaagacgcggaattgaagaaaatggacaaggacgaggacgaaggaaaacca
gacccgctcacacaactcgtaacgacgttctgtcgtggcgctatgacagaacgatctggc
gcgcttcaagaagatcctttgtacatgagctacgcgcaaattatatcgaaatcttgcggc
gaagaggaagaagaaggtgaagatgagggcggagggggcgaggaagaaggcggcgcttcg
atccacaagcggggccataagccacttatgcgaccgatgcacaaacttatggaacaagaa
atggaaaagcagaagcttcttttccaccaagcgcgactcgcgaatcgtggcgtggcagag
atggtactgcttcacatctcagcctgcaaaggtgttcccagcgagatggtgatgaagacc
ttggaattgggaatctccatcctacgcggcggtaatatagagattcaacgaggaatgctg
aaccatttgaaggaaaaaaaggacgtaggattcttcacatcgattgccggtctcatgaat
tcctgcagtgtattggatctggatgcgttcgaaaggaacacgaaagcggaaggtcttggt
gttggttccgagggagccgctggagagaagaacatgcacgatgctgagtttacatgtgct
ctatttcgttttattcaactgacttgcgagggtcataatcttgactggcagaattatcta
agaacgcaagctggtaacacaacaacggtgaacgtagtcatctgcaccgtcgattatcta
ctgcgactccaagaatccatcatggacttctattggcactattccagcaaggaactcatc
gaccctgccggcaaggctaattttttcaaagctattggcgttgccagtcaggtgttcaat
accctcactgaggtgattcaaggaccctgcgcacagaatcaacaagcattggcacattct
cgattgtgggacgcggttggtggattccttttccttttctctcacatgcaagacaagttg
tccaaacactcgagtcaggtggatctattgaaggagttgctcaacttgcaaaaagatatg
atcactatgatgttgtctatgctggaaggtaacgttgtaaatggaactattggaaaacag
atggtggacacattggtagaatctgcgggcaatgtcgagttgattctcaaatacttcgac
atgttcttaaaactgaaagatctcgtatcatctcctagcttcttagaggtggatttgaac
agcgatggctgggtgtatccgaaagattttaaagaaaaaatggaacaacagaagagctat
accgacgaggaaatcgaattcttattggcctgttgcgagacgaaccacgacggtaaaatc
gactacgtggctttcatggatcgtttccacgaaccggctaaagaaatcggtttcaatctt
gccgttctattaaccaatttatcggagcacatgccaaatgaaccaagattggcgagattc
ctcgaaacagcaggctctgtgttgaactatttcgagccatacctcggcagaatcgagatt
ctcggtggaaacaagaagatcgaacgcgtatactttgagatcaaggaatcaaacatcgag
caatgggagaaaccacaaattaaagaatcgaagaggacatatttctacaataccgtagta
gaggcaggagagaaagaaaaattggagactttcatcaacttctgcgaagacgctatcttt
gagatgcaacacgcgagtgcgttgatggcagtggaagaaagtggaggaatcgggaaagcc
agagaatcttcctatacctacatgacggatgacgacgaagaaagaaacaaggatcctatt
agaagaggcatccagacgtttaaggatagcatttacttcttcttctccatattctcccct
agcaacatcaagaacaagattgccgagatgcaacaaatgacatttttggaactctttatc
ggtttcttcaagatgattttctacgcgttctattattctggttttggcgttggttgcgtg
atcggatatttcatgaaattactgttggcgttgatgaaaggaccacacgtggaagagccc
gtagtcgaggtgaaagaggaggaggagaaaccatcgagacatttgcccgctttgccgcca
actccggatgagtctaatctacaggtacaagcgttcggaatggatataacgaaagaggaa
gggggacagataaagattgcacctcacgaatcggctacgtctacccctcaatcgagtatc
gaggaaacgggcgaaagtacaccggaagaagccactggagaagaaagtgcgagagctgag
ggaggtggagacatggaatcgcctgtttcgttggccgatttgttaggaggtgaacaagct
agagctcaggctgcagccgcggcagaagcagcggcagctcaacaagcagcaatggctgcg
gtcgaggcagaggcgaaacaagaaacgatagcagaaccatcagcctcctctatcgacttt
tccgagtacacgcatcgcgtcgtctccttcttggcaaggaatttttataatctgaaatac
gtggctctagtgctcgctttctgtatcaattttatgttgctgttctataaggtttcgtct
ttggatagcgaaggaggtgaggaaggaagtggtcagatagtggacatgttggcagagatg
tctggcgagggtgcatccggttctggaaatggcagtggagttgaaataggtagcggtagc
ggggaggctgaatcggaggaagaggaagacgaatacgctctggaatatgtggaagtggcg
gaggatttctattacatggcacacgttataaggctcatggctattcttcatgcgatcgtc
tctcttgctatgctagttgcctactatcatttgaaagtgccgttggctattttcaaacga
gagaaggaaattgcgcgacgcgtggaattcgatggtctgtatattgctgaaacaccggaa
gaggatgatatcaaagcacattgggataagatggtgatatcggcaaaaacgttccctgta
aattattgggataagttcgtgaagaagaaagttcgacagaagtacagtgagacctacgat
ttcgactacatcagtaatttgcttggcatggaaaagacatcgtttagtcaacaggaagaa
gaaggttctggtttgatacacttcatcgttaatatcgattggaggtatcaagtatggaaa
gctggagttaccatcacggataacgcattcttgtacagtttatggtactttacattttca
atacttggcaattataacaatttcttcttcgctgctcatttactcgacgtcgcagttggt
ttcaaaactctgagaacgatcttacagtctgtgacacacaatggcaaacaattggtgttg
acagtaatgttactgactattgtcgtctacatatatacggtcattgctttcaatttcttc
agaaaattctatattcaagaagaagacgatgaagtggacaaaaaatgccacgacatgtta
acatgcttcgtattccatttgtacaaaggtgtcagagctggtggtggtattggtgacgaa
attggtgaacctgatggcgatgattatgaagtttaccgtatcatgtttgatatcactttc
ttctttttcgtcattgttatcctgttggccattattcaaggtttgattatcgatgcgttc
ggtgaacttcgagatcaacttgagaacgtgaaaacgaatatggaaagcaattgtttcatt
tgtggtttaggaaaagaatatttcgatacggtaccacatggtttcgatactcatgtccaa
caggagcacaatcttgctaattatatgttcttcctcatgcacttaatcaataaaccagac
accgaatacaccggtcaagaaacgtacgtgtggaacatgtatcagcaaaggtgttgggat
ttcttcccggtcggtgattgcttccgcaagcagaacgaggcggtggaggaagaggcaaag
aaaaaataa

DBGET integrated database retrieval system