KEGG   Apis mellifera (honey bee): 408782
Entry
408782            CDS       T01057                                 

Name
(RefSeq) tubulin beta-1 chain
  KO
K07375  tubulin beta
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    408782
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ame03036]
    408782
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ame04812]
    408782
   04147 Exosome [BR:ame04147]
    408782
Chromosome and associated proteins [BR:ame03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     408782
Cytoskeleton proteins [BR:ame04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    408782
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   408782
  Exosomal proteins of colorectal cancer cells
   408782
  Exosomal proteins of bladder cancer cells
   408782
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_2 Tubulin_3
Other DBs
NCBI-GeneID: 408782
NCBI-ProteinID: XP_392313
BEEBASE: GB44133
UniProt: A0A7M7TEW6
Position
LG4:complement(12053300..12058225)
AA seq 447 aa
MREIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGTYHGDSDLQLERINVYYNEASGGKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLSTPTYGDLNHLVSLTMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALSVPELTQQMFDAKNMM
AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQEATADEDAEFDEEQEAEVDEN
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagggaaatcgtccacattcaagctggccagtgcggtaaccaaattggcgcaaagttt
tgggaaatcatcagtgacgagcatggtatcgacccaaccggtacttatcatggcgattcc
gatcttcaattggaaagaatcaacgtatactataatgaagcatctggagggaaatacgta
ccacgtgccatcctcgtcgatttggagccaggcacgatggactccgttcgctcgggacca
tttggccaaatatttagaccagataatttcgtgtttggacagtctggagctggtaacaat
tgggcaaaaggtcattacaccgaaggtgccgaattggtagactctgtcctcgacgtagtc
aggaaagaggccgaaagctgcgactgcttgcaaggtttccaattgacccactctttgggc
ggcggtaccggatccggtatgggaacgttgctcatctcgaaaattcgcgaagaatatccc
gatagaatcatgaatacatactccgtcgtaccgtcccctaaagtatcggacaccgtcgta
gaaccgtacaacgcaacgctttccgtacatcaactggtagaaaatacagatgaaacttac
tgcatcgataacgaggcactttacgacatttgcttccgcactctgaaattatccacgcct
acatacggtgatctgaaccatctcgtttcccttacgatgtctggtgtcactacttgcctg
aggttccccggccaattgaacgccgatctgagaaaactcgctgtgaacatggtaccgttc
cctcgtcttcacttcttcatgccaggattcgcaccgctcacgtctcgtggaagccaacaa
tacagagctctctctgtacccgagctaacccaacagatgttcgacgcgaagaacatgatg
gccgcctgcgacccgaggcacggaaggtatctcacggtggcggccattttccgtggcaga
atgtcgatgaaagaggtcgacgagcaaatgctcaacatccagaacaagaacagctcctac
ttcgtcgaatggatccccaacaacgtgaagacggccgtctgcgacatcccaccccgcggt
ttgaagatgtccgctaccttcatcggcaactcgacagccattcaagagctgttcaaacga
atctccgaacagttcaccgccatgttcaggaggaaagctttccttcactggtataccggc
gagggtatggacgagatggagttcaccgaggccgaatcgaacatgaacgacttagtttcg
gaatatcagcaataccaagaggccaccgcagacgaagatgcggaattcgacgaggaacag
gaagcagaagtcgacgaaaattaa

DBGET integrated database retrieval system