KEGG   Apis mellifera (honey bee): 408814
Entry
408814            CDS       T01057                                 

Definition
(RefSeq) gamma-secretase subunit Aph-1
  KO
K06172  gamma-secretase subunit APH-1
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    408814
SSDB
Motif
Pfam: Aph-1
Other DBs
NCBI-GeneID: 408814
NCBI-ProteinID: XP_006560654
BEEBASE: GB49536
UniProt: A0A088ADL0
AA seq 238 aa
MTVMDFFGCAFLAFGPPLAMFTFTVAAEPIRIIILIASAFFWLISLLLSSILWYAVVPLQ
NHLAFGLVFSVLFQEAFRYLLYWVLRKAERGLDKVTTTHVADSRHVFAYVCGLGFGFMSG
VFALVNVLADAVGPGTMGLRQGTEYFFVISAATTLCFILLHTFWGVVFFSALDRKNWGQV
IWVVGSHLFVSCMTLLNVKEAYVATTLSAYVILMITTALAFKVAGGRPQSIVQCFSRQ
NT seq 717 nt   +upstreamnt  +downstreamnt
atgacagttatggatttttttggttgtgcctttttggcttttggcccaccattagctatg
tttacatttactgtcgcagctgaacctattagaattattatactaatagccagtgccttt
ttttggttaatttctttattgttgtcatccatactctggtatgctgtagtgccattacaa
aatcatcttgcatttggacttgtattttctgtattatttcaagaggcattcaggtacctc
ttatactgggtactaagaaaagctgaaagagggttagataaagtaacaacaacacatgtg
gcagatagtagacatgtatttgcatatgtatgtggtttaggttttggttttatgagtggt
gtttttgcactagtcaatgtcttagcagatgctgttggacctggaacaatgggacttcga
caaggcacagagtacttttttgtaatatcagcagccacaactctttgctttatcttgctg
catacattttggggtgttgtatttttttctgctctggatagaaaaaattggggacaagtt
atttgggttgttggctcacacttgtttgtgtcatgtatgaccttgttaaatgtaaaagaa
gcttatgtagctactactttatctgcctatgtcattttgatgataacaactgcacttgca
ttcaaagttgcaggtggcagacctcaaagtatagttcaatgtttttcaagacagtaa

DBGET integrated database retrieval system