KEGG   Apis mellifera (honey bee): 408840
Entry
408840            CDS       T01057                                 
Name
(RefSeq) 5'-3' exoribonuclease 2 homolog
  KO
K12619  5'-3' exoribonuclease 2 [EC:3.1.13.-]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03008  Ribosome biogenesis in eukaryotes
ame03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    408840
  09123 Folding, sorting and degradation
   03018 RNA degradation
    408840
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ame03021]
    408840
   03019 Messenger RNA biogenesis [BR:ame03019]
    408840
   03009 Ribosome biogenesis [BR:ame03009]
    408840
   03016 Transfer RNA biogenesis [BR:ame03016]
    408840
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-
     408840
Transcription machinery [BR:ame03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     408840
Messenger RNA biogenesis [BR:ame03019]
 Eukaryotic type
  mRNA degradation factors
   5'-3' decay
    5' exonucleases
     408840
Ribosome biogenesis [BR:ame03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    408840
Transfer RNA biogenesis [BR:ame03016]
 Eukaryotic type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    408840
SSDB
Motif
Pfam: XRN_M XRN_N
Other DBs
NCBI-GeneID: 408840
NCBI-ProteinID: XP_392371
BEEBASE: GB44445
UniProt: A0A7M7R598
Position
LG5:9722200..9750791
AA seq 948 aa
MGVPAFFRWLSRKYPSVIVECIEQKPITTNGIRVPVNSAEPNPNGIEFDNLYLDMNGIIH
PCTHPEDRPAPQNEDEMMEAIFECIDRLFRIVRPRKLLYMAIDGVAPRAKMNQQRSRRFR
ASKEANEKINEIKRIRSELSLKGASLPPEKPKEEHFDSNCITPGTPFMARLSKCLHYYIH
DRLNNDPGWRNIKVILSDANVPGEGEHKIMDFIRRQRAQPDHDPNTQHVLCGADADLIML
GLATHEPNFTIIREEFKPNKPKPCDICGQLGHEMQECTGAEPNQREEANPFGSECQYIFV
RLNVLREYLERELQMPNLPFKYDFERVIDDWVFMCFFVGNDFLPHLPSLEIREGAIDRLV
NLYKKTVYKTGGFLTDSGDVNLDRVQLIMSELGDVEDEIFKKRQQNELAYKQREKDKKRR
LLGISNNKPKWIPTGQFAPTRIGEHIKPVQNARYEAYQMRIHGQNYHTSEKGNAKEMLES
MIRPENSTDHERKRKSEVVEDDSDDDQSHDEVRLWEDGFKDRYYESKFDVSPDNLVFRNN
VALQYVRGLCWVLRYYYQGCASWKWYFPYHYAPFASDFINIGGLSTEFEKGTIPFRPLEQ
LMGVFPAASSKHVPAPWAKLMSDPKSPIIDFYPEDFKIDLNGKKFAWQGVALLPFVDEKR
LFKALEPYYDCLTEAEKIRNVRGDDRLYVGLGNSGYNFMKGLYTNHVRSDAETSICIDGM
RGTVLLTDDCVGDGATLPSPINGLLPIRNNKVYCIKFRDPKYSSNFIFPAKKLKGVREPP
KVLKPQDFDQMNRNTGNTWKPQIGFTSSTQIASLTEAGKRILGHYTNHNRVPPSYNPIPI
PQTLYPQHHGYQSTNYQGGYDPGHNQQAMVPGPWARGYGTPHNYHQRYPEYQQKNNYNVQ
QYGRNNYQNPQYNSYGSQYNQQRNYSSNYQGNSGESGGSRGGGWRRST
NT seq 2847 nt   +upstreamnt  +downstreamnt
atgggtgtaccagcattttttagatggttgagtcgaaaatatccttctgtaatagtagaa
tgtatcgagcagaagccgataactacaaatggtatacgagtaccagtgaattcggcagaa
ccaaatccaaatggaatagaatttgataatttataccttgatatgaatggtattatacat
ccttgtactcatcctgaagatagacctgcaccacaaaatgaggatgaaatgatggaagct
atttttgaatgcattgaccgtttatttcgcattgtaagaccaagaaaattactttacatg
gcaattgatggagttgcacctagagcaaaaatgaatcaacaaagatcaagacgatttaga
gcatcaaaagaagcaaatgaaaaaattaacgaaataaaaagaatacgttctgaattatct
cttaaaggagcatctttacctcctgaaaaaccaaaagaagagcattttgatagcaattgc
attacaccgggcacaccatttatggcaagattatcaaaatgtttgcattattatatacat
gaccgtttaaacaatgatcctggatggagaaatataaaagtaattttgagcgatgcaaat
gtgccaggagaaggagaacataaaataatggattttatacgtagacaaagagcacaacct
gatcatgatcctaatacacaacacgttttatgtggagctgatgctgatttaattatgttg
ggtcttgcaactcatgaacctaattttactattattcgtgaagagtttaagccaaataaa
ccaaaaccatgtgatatatgtggtcaattaggacatgaaatgcaggaatgtacgggtgca
gagcctaatcagagggaagaagcgaatccttttggatctgaatgccagtacatatttgtg
cgattaaatgtactcagagaatatttagaaagagaattgcaaatgcctaatctaccattt
aaatacgatttcgagcgagttatcgatgattgggtgttcatgtgtttcttcgtaggaaac
gattttcttcctcaccttccatctttggaaattagagaaggggcaatagatagacttgtt
aatttatataaaaaaacagtatataaaacaggaggatttttaacagatagtggagatgtt
aatttagacagagttcaactgataatgtctgaattaggcgatgttgaagatgaaattttc
aagaaaaggcaacaaaatgaattagcctacaaacaacgtgaaaaagataaaaaaagaaga
ttattgggaattagtaataataaaccaaaatggattcccacgggacaatttgcaccgacg
cgtattggtgaacatatcaaaccagtacaaaatgcacgttatgaagcttaccaaatgcgt
attcatggtcaaaattatcatacaagtgaaaaaggaaatgctaaggagatgttagaaagt
atgatacgtcctgaaaattcgactgatcatgaacgaaaacgaaaaagtgaagtagttgaa
gatgattcagatgatgatcaatctcacgatgaagttagattatgggaagatggttttaaa
gatcgttattatgaatcaaaatttgatgtatctcctgataatttggtattcagaaataat
gtggcattgcaatatgtgcgtggtttgtgttgggttttacgatattattatcaaggttgt
gcttcatggaaatggtattttccgtatcattatgctccatttgctagcgatttcatcaat
attggtggtctttctaccgaatttgaaaagggaactataccattccgtccattagaacaa
ttgatgggtgtatttccagcggctagtagtaaacacgttcctgcaccgtgggcaaaatta
atgagtgatccaaaatcaccaattattgatttttatccagaagattttaaaattgattta
aatggtaaaaaatttgcttggcaaggggtagctttacttccttttgtggatgaaaaacgt
ttattcaaggcactagagccatattacgattgtttgacagaggcagaaaaaatacgaaat
gttcgaggagacgatcgattatatgtaggactcggtaatagcggttataattttatgaag
ggactttatacgaatcacgtacgatccgatgcagaaacttcaatatgtatagatggtatg
cgaggtacggttttattgacagatgattgtgtcggagacggagctactttaccttcgccc
ataaacggattattaccaattaggaataataaagtgtattgtattaaattcagagatcca
aaatatagtagtaattttattttccctgcgaaaaaattgaagggtgttagagaaccacca
aaagttttaaaacctcaagattttgatcaaatgaatcgtaacactggaaatacttggaaa
ccacaaattggtttcacttcctcgacacaaatagcttcattaactgaggcaggcaaaaga
atacttgggcattatacgaatcataatagagtgccaccgtcatacaacccaataccaata
ccacaaacgttatatccacagcatcacggttaccaaagtacgaattatcaaggaggttac
gatccaggacataatcagcaggcgatggttcctggtccatgggcaaggggatacggcact
ccgcacaattatcatcaacggtatccggaatatcagcaaaagaataattacaacgtccag
caatacgggcgaaataattatcaaaatccacaatataatagttatggttcgcagtataat
caacaacggaattattcttctaactaccaagggaatagtggtgaaagtgggggaagtagg
ggaggaggatggagacggtcaacgtag

DBGET integrated database retrieval system