KEGG   Apis mellifera (honey bee): 409127
Entry
409127            CDS       T01057                                 

Name
(RefSeq) tyrosine-protein kinase Abl isoform X2
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ame01001]
    409127
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     409127
Protein kinases [BR:ame01001]
 Non-receptor tyrosine kinases
  ABL family
   409127
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 Haspin_kinase SH3_3 ABC1
Other DBs
NCBI-GeneID: 409127
NCBI-ProteinID: XP_006571661
BEEBASE: GB54910
Position
LG1:24122685..24130974
AA seq 1433 aa
MGAQQTKERIVPVGSAARQTRKQPRNLKESRLVGSNIFTEHSEALLQSRPLPHIPALPDG
DPPNGSGIQPISQQMNIQQHSGVSSTGLLEAANRWTSKENLLAQEEDDPQLFVALYDFQA
GGENQLSLKKGEQVRILSYNKSGEWCEAHSSTGQVGWVPSNYVTPVNSLEKHSWYHGRIC
RNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINEDSEGKMFVTTESKFN
TLAELVHHHSMLADGLITQLLYPAPKHNKPTVFPLSPEPDEWEINRTDIVMRHKLGGGQY
GDVYEAVWKRYNMTVAVKTLKEDTMALKDFLEEAAIMKEMKHRNLVQLLGVCTREPPFYI
ITEFMSKGNLLDYLRNESKHQINAVVLMHMATQIASGMSYLESRNFIHRDLAARNCLVGE
NHLVKVADFGLARLMRDDTYTAHAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGILLWEIA
TYGMSPYPGVDLTDVYHMLEKGYRMECPPGCPPKVYELMRQCWQWSAADRPTFKEIHHSL
ENMFQESSITEEVEKQLQGGGEIPLLSYKKSQTGSTGNIHGLVLVSEPLPPSDTTSSVTK
LSTFTGGISSKNNSSIVQMRRSTNKKGKQAPAPPKRTSSFRDSAYQEQDTQNTETNTMTL
DDATDLNGIDKILEGIARDLATMAQGTIAAGGCEIEEDGEGSQGTAEPNFISQPSTSPEP
IPGLTCSQKQIKPRPYPSKEPLPQKLVQVGALEVQNVKRAINRYGTLPKGARIGAYLESL
RQSGMPSNQESTTVASSITSGTVEQHETIDNSQHRSLSPRQNNLRSQPQMTRSNSSSGVV
NTYQPPNSPRGRIVTVRKNNQSDGVGLRTFRVSSNSNFRTASPSRSVQPSLADLEFPPPP
ADLPPPPDEIFSSQEQTELPPPISCSEISQIRNSPLSIRKAKSTDWRAKEDENEQEDRND
VSNAEPSVKEACSRFGVNLRRRETQDSSCRTIDNKRTGFKSRIDTIEPAAPPEEAPPPPP
PPPPPVSNSPPDSFERKPGMKEMLELKLINEIKQSAETKHGTTTKKTVTSSTPSALLDPA
SQLLSELCASFNMDTGQRHAQNEYAVSTLKTNEANQDQQHHPYKDSSISSSTTESILSGG
NVGFKLKRVDKRNNPQKEETSDGQIIDFKARLRKVENAEKERSLEEKSTITEQSSESEEQ
QDDKRRSTGSISSLKKLWENKESCDSQPHSPKLSVRGNSGKQETLDQTEDSPEDHSGAST
RSQSSGSKSDTRLWPPTEPEKPVVPAKPLKPLSSSTKHFGSSIYATPNCTKSQHAEDDLS
KQNTDSRTAKQIVLELSTLIENSVLNLKSSSTIVMTSWLQLSDKVGLLHGMCANLADSGI
APHARFQFRELLARLELQARQLRAAGTRNVTENTRLLTDLQNTIKDVVNTVQR
NT seq 4302 nt   +upstreamnt  +downstreamnt
atgggtgctcaacagactaaggaaagaattgttcctgtcggctctgctgcgcgacaaaca
cgcaaacagccaagaaacctcaaagagtcccgtcttgttggctctaatatatttacggag
catagcgaagctcttttacaaagtagaccgctacctcacattccggcattaccagatggt
gatcctccaaatggatccggtattcaaccaatttcacaacaaatgaatattcagcaacat
agtggagtttcttctactgggctcttggaggctgcaaatagatggactagtaaagaaaat
ctattagcacaagaagaagatgatccccaattatttgttgctctatatgatttccaagca
ggcggagagaatcaactaagtcttaaaaaaggagaacaagttcgtattttaagttataat
aagagtggagaatggtgtgaagctcattcaagtactggtcaagtaggatgggttccttca
aattatgtcacaccagtaaattcacttgagaaacattcttggtatcatgggaggatatgt
aggaatgctgctgaatatctattaagttctggtataaatggtagctttttagttcgtgaa
tcagaaagcagtccaggtcaacgcagtatttctctacgatatgagggtagagtataccac
tacagaattaatgaagacagtgaaggaaagatgtttgttacaactgaaagtaaatttaac
actctggcagaattagtacatcatcattcaatgcttgccgatggtttaattacacaatta
ctttatcctgcaccaaagcacaataagcctactgtttttcctcttagtccagaacctgat
gaatgggaaattaataggacagacattgttatgagacataaattaggtggtggacaatat
ggagatgtttatgaagctgtatggaagagatacaatatgactgtagcagtaaaaacatta
aaagaggatacaatggctctaaaagattttctggaggaagcagcaattatgaaggaaatg
aagcatagaaatttagttcagttattaggtgtatgtactcgagaaccacctttttacatt
attacagaattcatgagcaaagggaatctattagactacttacgaaatgagagcaaacat
caaatcaatgctgttgttttgatgcatatggctacacaaatcgccagtggaatgagttat
ttggaaagcagaaatttcattcatagagatttagcggctcgaaactgcctagtgggtgaa
aatcatctggtaaaggtcgcagacttcggcttggctcggttgatgagagatgatacgtac
acggctcatgctggagcgaaattccctataaaatggactgctccagaaggattagcatat
aataaattttctacaaagtctgatgtatgggcatttggaattttactttgggaaatagca
acatatggaatgtctccttatcctggtgttgatttaacagatgtgtatcatatgttagaa
aaaggttacagaatggaatgtcctcctgggtgtccaccaaaagtatatgaattgatgcgc
caatgttggcaatggtctgctgctgataggccaacttttaaagaaattcatcattctctc
gaaaatatgtttcaagaatctagcattacagaagaagttgaaaagcagttacaaggagga
ggagaaattcccttactttcatataaaaaatctcaaactggtagtactggtaatattcat
ggacttgttttagtttctgagccattacctccctcagatactaccagttcagtaacgaaa
ctgagtacattcacaggtggtatatcaagtaagaacaatagtagtatcgtacaaatgaga
cgttctacaaataaaaaaggaaaacaagctccagctcctccaaaacgaacgagttcgttc
cgcgattctgcctatcaagaacaagatactcaaaacactgaaacaaacaccatgactctc
gacgatgccacggatctaaatggtattgataagattctcgaaggtattgcgcgagatctc
gcgacgatggctcaaggaacgattgctgcaggaggctgtgaaatcgaggaggatggagag
ggttctcagggtacggcggaaccaaattttatctctcaaccttcaacatctccggaacct
atacctggcttgacctgttctcaaaaacaaattaaaccgagaccttatccatcaaaagaa
ccactaccgcaaaaattggtacaagtaggtgcattagaagtacagaacgtgaaaagagcc
attaatcgttacggaacattaccaaaaggtgctagaattggcgcatatttagaatctttg
cgtcaaagtggtatgccatcaaatcaagaatctacgacagtagcttcatccataacatct
ggcacagtggaacaacatgaaactattgataattctcaacatagatctctttcccctcgt
caaaataatttacgaagtcaacctcaaatgactcgtagtaattcttcaagcggtgttgtt
aatacttatcaacctccaaattctcctcgtggtcgaatagtaactgtaagaaagaataat
caatctgatggcgttggtttaagaacttttcgggtttcgagtaattctaattttcgtact
gcaagtccctcgagatccgttcaaccatcattagctgatttagaatttcctcctccacct
gcagatttgcctcctccaccagatgaaattttttccagtcaagaacaaactgaacttcca
cctcctatttcttgcagtgaaatttctcaaataagaaattcccctttatctataagaaaa
gcaaagagtacagattggcgtgcaaaagaggatgaaaatgaacaagaagacagaaacgat
gttagtaatgcagagccctctgtaaaagaagcctgttcgaggtttggagttaatttaaga
cgcagagaaactcaagatagctcatgtagaactatcgataataaaaggacgggttttaaa
tccagaatagataccattgaacctgctgcaccaccagaagaagcacctcctcctcctccg
ccgcctccaccaccagtttcaaattcacctcctgatagttttgaacgtaaacctggaatg
aaggaaatgttagaattaaaattgataaatgaaataaagcagagtgcagaaacaaaacat
ggtacaactacaaaaaaaactgtaacaagtagtactccatctgctcttctggaccctgct
tcacaattactttcagaactttgtgctagttttaatatggatacaggacaaagacatgct
caaaatgagtatgctgtatcaactttaaaaactaatgaagcaaatcaagatcaacagcat
catccttacaaagattcatccatatcttcttcaacaactgaatctatactttctggtgga
aatgtcggttttaaattgaaaagagtagacaaacgaaataatccacaaaaagaagagaca
tctgatggacaaataattgatttcaaagctagacttcgaaaagttgagaatgcagaaaaa
gaaagatccttagaagagaaaagtactatcactgaacaatcttcagaatcagaagagcaa
caagatgataaacgtagaagtactggtagtattagtagtttaaaaaaactttgggaaaat
aaagaatcttgtgatagtcaacctcacagtccaaaacttagtgttagaggaaatagtggt
aaacaagaaactcttgaccaaacagaagattctcctgaagatcatagtggagcctcaact
cgtagtcagagctctggtagtaaaagtgatactagactatggccaccaactgaaccagaa
aaaccagtggttcctgcaaaaccactaaaaccattatcttcttcgactaaacattttggt
tcttcaatatatgcaacaccgaattgtacgaaatctcaacatgcagaagatgatttaagt
aaacagaatacagattcaagaaccgcaaaacagattgtattggagctttcaacattaatt
gaaaacagcgtattaaatttgaaaagtagctcaacgatagtaatgactagttggttgcag
ctttcagacaaggtaggattgttacatggaatgtgcgctaatcttgcagatagtggtatt
gctccacatgcgcggtttcaatttcgcgagcttcttgcaaggttagaacttcaggcacga
caacttcgtgcagctggcactcgaaatgttacggagaatacaagacttctcactgatctt
caaaacacgataaaagatgttgtcaataccgtgcaaagataa

DBGET integrated database retrieval system