KEGG   Apis mellifera (honey bee): 409150Help
Entry
409150            CDS       T01057                                 

Gene name
Echs1
Definition
(RefSeq) enoyl Coenzyme A hydratase, short chain, 1, mitochondrial
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00062  Fatty acid elongation
ame00071  Fatty acid degradation
ame00280  Valine, leucine and isoleucine degradation
ame00310  Lysine degradation
ame00380  Tryptophan metabolism
ame00410  beta-Alanine metabolism
ame00640  Propanoate metabolism
ame00650  Butanoate metabolism
ame01100  Metabolic pathways
ame01200  Carbon metabolism
ame01212  Fatty acid metabolism
Module
ame_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
ame_M00085  Fatty acid biosynthesis, elongation, mitochondria
ame_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    409150 (Echs1)
   00650 Butanoate metabolism
    409150 (Echs1)
  Lipid metabolism
   00062 Fatty acid elongation
    409150 (Echs1)
   00071 Fatty acid degradation
    409150 (Echs1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    409150 (Echs1)
   00310 Lysine degradation
    409150 (Echs1)
   00380 Tryptophan metabolism
    409150 (Echs1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    409150 (Echs1)
Enzymes [BR:ame01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     409150 (Echs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 409150
NCBI-ProteinID: XP_001123353
BEEBASE: GB40460
UniProt: A0A087ZNZ9
Position
LG8
AA seq 295 aa AA seqDB search
MTILRIGKILFVKQVQIGRKPQYFASDTKYYCSYVPQNYEFIKVETAGEKKNIGLITLNR
PKALNALCEKLITELNDAMLKFDTNNNIGAIIITGSEKAFAAGADIKEMKNNTFAYNIRN
KFLNNWNISEISKPVIAAVNGYALGGGCELAMMCDIIYAGDTAKFGQPEITIGTIPGAGG
TQRLTRIIGKSKAMEMVLTGKQINAEEAEKNGLVSKIFPANKLIAEAIKLGEKIASHSQL
IVAMAKESVNIAYETTLKEGLHFEKNIFHGTFATDDRKEGMTAFIEKRSPKFNNQ
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacaattctacgcattggaaaaattttatttgtcaaacaagtgcagattggtcgaaaa
ccacagtattttgcatccgatacgaaatattattgttcctatgttccacaaaattatgaa
ttcattaaagtggaaactgctggagaaaaaaaaaatattggtttgattactttaaacaga
ccaaaagctttaaatgctctttgtgaaaaattgataactgaattaaatgatgctatgtta
aaatttgatactaataataatatcggagctataataattacaggcagtgaaaaagcattt
gcagctggtgctgacattaaggaaatgaagaacaatacttttgcatataatattagaaat
aaatttcttaataattggaacatttctgaaatatcaaaaccagtaattgctgctgtaaat
ggatatgctttaggtggaggttgtgaattagcaatgatgtgtgatattatttatgctgga
gatacagcaaagtttggtcaacctgaaatcactattggtaccatacctggtgcaggtggt
actcaaagattaactagaataattggcaagagtaaagcaatggaaatggtattaacaggc
aaacaaatcaacgctgaagaagcagaaaaaaatggtttggttagtaaaatttttccagca
aacaagcttattgctgaagcaattaaattgggtgagaaaattgcttctcattctcaatta
attgttgctatggcaaaagaatctgttaatattgcttatgaaactactttaaaagaagga
cttcattttgaaaaaaatatattccatggtacatttgcaacggatgatagaaaggaaggg
atgacagcattcattgagaaaagatcacctaaattcaataatcaataa

DBGET integrated database retrieval system