KEGG   Apis mellifera (honey bee): 409261
Entry
409261            CDS       T01057                                 

Name
(RefSeq) glycerol kinase 3 isoform X2
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00561  Glycerolipid metabolism
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    409261
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ame04147]
    409261
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     409261
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   409261
SSDB
Motif
Pfam: FGGY_N FGGY_C
Other DBs
NCBI-GeneID: 409261
NCBI-ProteinID: XP_006570858
BEEBASE: GB47411
UniProt: A0A7M7GZ32
Position
LG1:complement(15161329..15173530)
AA seq 504 aa
MEQDPKEILFAVKACIKDVIRKLDVLGLKMDEIVTIGITNQRETTVAWDAMTGEPLYNAI
VWSDIRTSSIVDQIIAKFPDQSKNHIKPLCGLPVSPYFSALKIRWMKDNVPTVRKAMRDR
RCKVGTMDTWIVWNLTGGKDGGLYITDVTNASRTMLMNIETLSWDPTLCRYFDIPMQMLP
EIRSSAEIYGKIAIGPLKGITISGILGNQQSALVGQNCLKKGQAKNTYRSGCFLLCNTGT
TRVYSSHGLVTTVAYQLGPKSSAVYALEGSIAVAGAAIKWLRDNMKLIKDVHESEHLAQS
VFSTGDVYFVPAFTGLYAPYWRKDARGIICGLTAFTTKQHIIRASLEAVCFQTRDILEAM
YKDCGFPLTKLNTDGKMSTNNLLMQLQADLCGTPVFRSTMPDITALGAAMAAGHAEGVDI
WELEGEEIETVSTDTFLPTTTPEERDARYKKWKMAVERSLGWAAVKKSDQMTDERYYVLA
SIPASWFLMTSFILLRLSYYLKNR
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggaacaggatcccaaagaaattctttttgcggtaaaagcttgcatcaaagatgttata
cggaaattagacgtgttaggtttaaaaatggacgaaatagtaacaattggtattacgaat
caaagagaaactactgtagcatgggatgcgatgactggtgaaccattatacaatgcaata
gtatggtctgatattagaacgagttcgattgttgatcaaataatagctaaatttccggat
caaagtaagaatcatatcaaacctttatgcggtttgccagtgagtccatatttttcagca
ttaaaaatacgttggatgaaagataatgtgcccactgttagaaaagcgatgcgagatagg
cgatgtaaagtgggtacgatggacacttggatcgtttggaatttaacgggtggcaaagac
ggtggattatatattactgacgtaacaaacgcgtcaaggaccatgttaatgaacatagaa
actctttcatgggatcccacgttgtgcagatattttgatattcctatgcaaatgttgcca
gaaattagaagcagtgctgaaatttatggaaaaattgcaatcggtccattaaagggtatc
actatatctggcattttagggaatcagcaatcagctttagttggacaaaattgtttaaag
aaaggacaagcaaaaaacacatatagaagtggatgttttttactctgtaatacgggaaca
acacgagtatattcttctcatggattagtgacaacggtagcttatcaattaggtccaaaa
agttcagctgtttatgcattagaaggttcaattgcagtagcaggtgcagctattaaatgg
ttacgagataatatgaaacttataaaggatgtacatgaaagtgaacatttagcacaaagt
gtttttagtactggcgacgtatattttgtgccagcttttacaggattatatgctccatat
tggagaaaagatgcaagaggaattatttgtggacttactgcatttacaacaaaacagcat
ataataagagcatcattagaagctgtctgttttcaaactagagatattttagaagctatg
tataaagattgtggttttccattaaccaaattaaatacagatggaaaaatgtcaacaaat
aatcttcttatgcaattgcaagcagatctttgtggtacaccagtatttaggtccacaatg
ccagatattacagctttaggcgcggcaatggcagcaggtcatgcagaaggtgtggatatt
tgggaattagaaggtgaagaaatagaaacagtatcgactgatacatttttgccaacaaca
acaccagaagaaagagatgccagatataaaaaatggaagatggcagttgaaagaagttta
ggttgggcagcagtaaagaaatctgatcaaatgacagacgaaagatattatgtactggcg
tcgattcctgcaagttggttcttaatgacaagttttattttattacgattaagttattat
ttgaaaaatcggtga

DBGET integrated database retrieval system