KEGG   Apis mellifera (honey bee): 409286Help
Entry
409286            CDS       T01057                                 

Gene name
bsk
Definition
(RefSeq) stress-activated protein kinase JNK
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04013  MAPK signaling pathway - fly
ame04068  FoxO signaling pathway
ame04137  Mitophagy - animal
ame04140  Autophagy - animal
ame04141  Protein processing in endoplasmic reticulum
ame04214  Apoptosis - fly
ame04215  Apoptosis - multiple species
ame04310  Wnt signaling pathway
ame04391  Hippo signaling pathway - fly
ame04624  Toll and Imd signaling pathway
ame04933  AGE-RAGE signaling pathway in diabetic complications
Module
ame_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    409286 (bsk)
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    409286 (bsk)
   04310 Wnt signaling pathway
    409286 (bsk)
   04391 Hippo signaling pathway -fly
    409286 (bsk)
   04068 FoxO signaling pathway
    409286 (bsk)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    409286 (bsk)
   04137 Mitophagy - animal
    409286 (bsk)
  Cell growth and death
   04214 Apoptosis - fly
    409286 (bsk)
   04215 Apoptosis - multiple species
    409286 (bsk)
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    409286 (bsk)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    409286 (bsk)
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     409286 (bsk)
Protein kinases [BR:ame01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   409286 (bsk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH RIO1 Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 409286
NCBI-ProteinID: XP_006557300
BEEBASE: GB56012
Position
LG3
AA seq 527 aa AA seqDB search
MLVEFLWERQGSIITRSHSLRIQSLNVDLSQWPLVYDESGAHKKRGAKRRGGGGVVRKRG
AEKKRRGAGAGPDTGPGARAPRADEKTGARGHVSFRPGTLALRSKVAKSVSPHRVHQECS
SGGEVQVQVQQERRAPRRMPYLGPDMTTRLSAMFYTVEVGDTRFTILKRYQNLKPIGSGA
QGIVCAAYDTVTAQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQR
SLDEFQDVYLVMELMDANLCQVIQMDLDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSN
IVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMG
EMIRGGVLFPGTDHIDQWNKIIEQLGTPAQEFMQRLQPTVRNYVENRPRYPGYPFDRLFP
DVLFPSDSSEHNRLKASQARDLLSRMLVIDPERRISVDDALLHNYINVWYDEGEVNAPAP
GPYDHSVDEREHTVDQWKELIYQEVMEYETSHNPTTVAQTSESGESR
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctagtggaatttttatgggaaagacaaggatcaataataacaagatctcactcgctt
cggattcagtccctcaacgtcgacctttcacaatggccgctcgtttatgacgaatccggc
gcgcataagaagcgaggagcaaagcggcggggcggcggcggcgtcgtccggaagcgagga
gcagagaagaagcggcgtggtgccggcgccggtcccgacaccggtcccggtgcacgtgcc
cctcgggctgacgagaaaacaggggcaagaggccacgtttcctttcggccaggtacgctc
gcactacggtccaaagtggctaagagcgtaagtcctcatcgagtgcaccaggagtgctcg
agcggaggggaggtgcaggtacaggtgcagcaggagagacgagcaccgaggcgcatgcct
tacctggggcctgatatgacaacccggctatccgccatgttttacacggtcgaagtcggg
gacaccagattcactattctcaagcggtatcagaatttgaagccgatcggttccggtgcg
cagggaatcgtttgcgcggcgtacgacacggtgacagcgcagaatgtcgcgatcaagaaa
ctgtcgagaccttttcaaaacgttacgcacgcgaagagggcctacagggaattcaagctg
atgaagctggtcaatcacaaaaacataatcggtttgttgaacgcgttcacgccacaacgg
tccttggacgagtttcaagacgtttacttagtgatggaacttatggacgcgaatctatgc
caggtaatccagatggatctggatcacgaacgtatgtcttatctgctttatcaaatgctg
tgcggcatcaaacacttacactcggccggtatcattcacagggatttaaagccgagcaat
atagtggtaaaggccgactgtacattgaagattctcgattttggcctggccagaactgcc
gggaccactttcatgatgacgccatacgttgtgacacgatattatagggcgccagaggtg
atcctcgggatgggatacaaggagaacgtggacatttggtcggtcgggtgcataatgggc
gaaatgattcggggtggcgtcctctttcccgggacggatcacatcgaccaatggaacaag
ataatcgagcaactgggaacgccggcgcaggaattcatgcagcggctccagcctacggtc
aggaattacgtggagaacaggccacggtatccgggatatccgttcgacaggttattcccg
gacgttctgtttccatcggattcgtcggaacacaacaggttgaaagctagtcaagccagg
gatctattgtcgcgcatgctcgtgatcgaccccgaacgacgcatctccgtcgacgatgct
ttactacataattacataaacgtgtggtacgacgagggcgaagtcaatgcccctgcacca
ggcccgtacgaccatagtgtcgatgagagggagcatacggtggaccagtggaaagagctg
atctaccaggaagtgatggaatacgagacgagccataatcccacgacagtagctcaaacg
tccgagagcggcgaatcccggtag

DBGET integrated database retrieval system