KEGG   Apis mellifera (honey bee): 409324
Entry
409324            CDS       T01057                                 

Name
(RefSeq) uncharacterized protein LOC409324
Organism
ame  Apis mellifera (honey bee)
SSDB
Motif
Pfam: ECH_1 ECH_2 HTH_36 Phosducin
Other DBs
NCBI-GeneID: 409324
NCBI-ProteinID: XP_006557395
BEEBASE: GB49643
UniProt: A0A7M7GNA7
Position
LG4:172503..174034
AA seq 315 aa
MHSIKQISNIINLYYKSYLRRCLTSKSSENVLKEIDREQKEKNIVVEYFEDVAMIGINRP
ETKNALNVATAQELADEIDKFENDENCLIGVLHGIGGNFCSGYDLKEIAQYNGKNEEVLP
QFGALANKIELSKKPLIAAINGYALGVGFELALMCDLRVMEESALLGFANRRFGIPILCG
GTVRLPALIGYSRAMDLILTGRHIDAKEAFSCGLINRYTAVGNVIGHAVNFARSFVKFPK
KTLLADRASVHYATFSAKQLEEAMQFEKDNASHLLFEEGVEGAKRFVTEGLGKHGKFYNI
TKINLKFKELDKDLL
NT seq 948 nt   +upstreamnt  +downstreamnt
atgcattctataaagcaaatatcgaatataatcaatttatattataaaagttatttacga
agatgtttaacctctaaatcatctgaaaatgttttgaaagaaattgatagagaacaaaag
gaaaaaaatatagtagtggaatattttgaagatgttgctatgattggtataaatcgacct
gaaacaaaaaatgctttaaatgttgcaactgcacaagaactggcagatgaaatagataaa
tttgaaaatgatgaaaactgtttaatcggtgtacttcatggaataggaggaaatttttgt
agtggttatgatcttaaagaaattgcacaatataatggaaaaaatgaagaagttttacct
caatttggagcattggctaataaaattgaattgagtaaaaaacctttaatagctgctata
aacggatatgctctaggagtaggatttgaacttgcattaatgtgcgatcttagagtaatg
gaagaaagtgcattattaggttttgccaatagacgatttgggatacccatattatgtggt
ggtacggttcgattacctgctctaattggatattcaagagcaatggatttgattttaact
ggtcgtcatattgatgcaaaagaagcattttcatgtggtttaattaatcgttatacagcc
gttggtaacgtgataggacatgcagtaaattttgcaagatcttttgtgaagtttcccaaa
aaaacgctgcttgccgatcgagcttctgtacattatgctacattttctgctaaacaatta
gaagaagctatgcaatttgagaaagacaatgcatctcatttattatttgaagaaggagtt
gaaggtgcaaaaaggtttgttacagagggattaggaaaacatggaaaattttataatatt
acgaaaataaatttgaaatttaaggaattggataaagatcttttatga

DBGET integrated database retrieval system