KEGG   Apis mellifera (honey bee): 409499
Entry
409499            CDS       T01057                                 
Name
(RefSeq) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00052  Galactose metabolism
ame00520  Amino sugar and nucleotide sugar metabolism
ame01100  Metabolic pathways
ame01250  Biosynthesis of nucleotide sugars
Module
ame_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    409499
   00520 Amino sugar and nucleotide sugar metabolism
    409499
Enzymes [BR:ame01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     409499
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD RmlD_sub_bind KR NAD_binding_4 adh_short NAD_binding_10 NmrA CoaE UDPG_MGDP_dh_N HTH_18
Other DBs
NCBI-GeneID: 409499
NCBI-ProteinID: XP_016769990
BEEBASE: GB51079
UniProt: A0A7M7R3P6
Position
LG10:9513014..9516044
AA seq 363 aa
MTKDWRTIFVTGGAGYIGSHCIIELLESGYDVIAIDNFANSVTESGESAALKRVEQITGK
KVTFYNCDLIDRDKLEIVFNKHKIDCVIHFAAIKAVGESMQIPLHYYRNNIIGAINLLEV
MKAAGCFQLVFSSSCTVYGEPNQLPITEEHPTGNITNVYGRTKYFIEEMLKDISRAEKNW
NIISLRYFNPVGAHQSGLIGEDPTKPFTNLMPYIAQVALRHKPELVIFGGDYPTKDGTGI
RDYIHVMDLAAGHVAALNALYKQHLRLKIYNLGTGKGVSVLELIKIFENVTGTTVPYVIK
DRREGDIVSMYANTDLAEKELGWTTKYNVERMCEDFWRWQTMNPHGYRNSIKNGINEYIN
GTL
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgaccaaagattggagaactatttttgtaactggaggagcgggttacattggtagtcat
tgtatcattgaacttttagaaagtggatatgatgttattgcaatagataattttgctaat
agtgtaactgaaagtggtgaatctgcagctcttaaaagagtggaacagattacaggaaaa
aaagttactttttataattgcgatctcattgatcgagataaacttgaaattgtttttaat
aagcataaaatagattgtgtaattcattttgcggctataaaggcggttggcgaatcaatg
caaattccgcttcactattatcgaaataatattatcggtgccatcaatttgttagaggta
atgaaagctgctggatgtttccaattagtgtttagtagttcttgtactgtatatggagaa
ccaaatcaacttccaattacagaagaacatccaacaggaaatattacaaatgtatatggt
cgaacaaaatattttattgaagaaatgcttaaagatatatcgagagctgaaaagaattgg
aatattatttccctaagatattttaacccagtaggtgctcatcaaagtggtttaattgga
gaagatcctacaaaaccatttacaaatttaatgccttatatagcacaagtagctttaaga
cataaacctgaacttgtcatttttggtggtgattatcctacaaaagatggtacaggtata
cgtgattacattcatgttatggatttagctgctggtcatgtagcagctttaaatgcttta
tataaacaacatttgaggctaaaaatttataatttaggtactggtaaaggtgtatccgta
ctcgaattaattaaaatttttgagaatgtcacagggacaacagtaccatatgttattaaa
gatagaagagagggtgatatagtatctatgtatgctaatacagatttagcagaaaaagaa
ttgggatggacaactaaatataatgttgaacgaatgtgtgaagatttctggagatggcaa
actatgaatccacatggttatcgtaactcgataaaaaatggtattaatgaatatataaat
ggcactttgtaa

DBGET integrated database retrieval system