KEGG   Apis mellifera (honey bee): 409515
Entry
409515            CDS       T01057                                 
Name
(RefSeq) long-chain-fatty-acid--CoA ligase 4 isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00061  Fatty acid biosynthesis
ame00071  Fatty acid degradation
ame01100  Metabolic pathways
ame01212  Fatty acid metabolism
ame04146  Peroxisome
Module
ame_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    409515
   00071 Fatty acid degradation
    409515
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    409515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ame01004]
    409515
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ame04147]
    409515
Enzymes [BR:ame01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     409515
Lipid biosynthesis proteins [BR:ame01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   409515
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   409515
  Exosomal proteins of breast cancer cells
   409515
SSDB
Motif
Pfam: AMP-binding AMP-binding_C MGDG_synth
Other DBs
NCBI-GeneID: 409515
NCBI-ProteinID: XP_006561670
BEEBASE: GB42732
UniProt: A0A7M7GPZ1
Position
LG9:complement(6414472..6430599)
AA seq 715 aa
MIVDEKSEMESFWIISAINALKALSYVYDLLTFPMYLILQRPWKRRKASRRIKARPIAKD
DKSITYRSVDEPQEVHIMLERENIDTLDKIMLWITKEHKGKKCVGTRQILAEEDEVQPTG
RIFKKYKMGEYKWKTYLEVEMLMTAFGRGLKEYGLTSSRNIVIFAETREEWMIAAYGCFK
QNLVVVTLYATLGEEAIAHGINETEVDIVITSHDLLPKFKSLLKILPKVKTIVYMEDQLK
PTDTKGYKEGVKLIPFSEVIKKGNISTAPLLSPQSDDTAIIMYTSGSTGIPKGVLLSHKN
VISVMKTFCDIVEIKPDDVFLAFLPLAHVFELLAESVCLLSGVPIGYSSPLTMIDSSSKI
QKGSKGDASVLRPTCVTSVPLILDRISKGINEKVMKSGFLSRAIFKFAYNYKLKWYKRGY
DTPFLDKYVFGAARQVLGGRVRLILCGGAPLTPDTQTQIKICLCVTLTQGYGLTESTSCA
TVMDKDDTSIGRVGGPTTICDIRLVNWEDAGYRVTDVPYPRGEIIIGGENISAGYYKLLD
KTKEDFFQEDGKRWFRTGDIGEIHEDGCIKIIDRKKDLVKLQFGEYVSLGKIEAELKTCP
IVENICVYGDSYKTFTVALIVPNAFYLEQIARNIGINGKNFEELCNDPQIEKAVLQELIE
QAKKCKLQRYEIPAAIKLCSEQWSPDMGLVTAAFKLKRKAVQERYQHEINRMYAS
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgatcgtggacgagaaatctgaaatggaaagtttctggattatcagcgcgatcaacgcg
ctcaaggcgctttcctatgtgtacgacctgttaacgtttccaatgtacctcatactccag
cgaccatggaaaaggagaaaggcttcccgaaggattaaagctcgacctattgcgaaagat
gataagagtattacttataggagtgttgatgaaccacaagaagtacacatcatgcttgaa
cgagaaaatatcgatacacttgacaaaataatgctttggattactaaggagcataaaggg
aaaaaatgtgttggtacaaggcagatacttgctgaggaggatgaggttcaacctactggt
agaatatttaaaaagtataaaatgggagaatataaatggaaaacttatttggaagttgaa
atgcttatgactgcctttggtcgaggtttaaaagaatatggtcttacgtcgtctagaaat
atcgtcatctttgccgagactagagaggaatggatgattgcagcttatggttgcttcaag
cagaatttggttgtagtaactttatacgcgactctaggtgaagaggccattgctcacggg
attaatgaaacagaagtcgatatcgtgataaccagtcatgacttattgccgaagtttaaa
tcgctccttaaaatattacctaaagttaaaacgattgtttacatggaagatcaattaaaa
cctactgatacaaagggttataaggaaggtgttaagcttataccattctctgaggtgata
aaaaaaggtaacatttccactgcaccattgttatcaccacaaagtgatgatactgcaatt
attatgtatacatctggatcaaccggaataccaaaaggtgtacttctatcacataaaaat
gtgatttctgtaatgaaaacgttttgtgatatcgtcgaaattaaaccagatgatgtcttt
cttgcatttttacctttggctcatgttttcgaacttcttgctgagagtgtgtgcttatta
tctggagtacctatcggctatagttcgcctcttactatgatcgattcaagtagcaaaatt
caaaaaggatccaaaggggatgcatcggttcttcgcccaacttgtgtaacttctgtacct
cttattctggatcgtatttccaaaggtattaatgaaaaagtaatgaaatcgggattttta
agtcgagcaatttttaaatttgcctacaactataaattgaaatggtataaacgtggttat
gatactccttttttggataaatatgtttttggagctgcaagacaagttcttggtggaaga
gttcgccttattctttgtggtggtgctcctttgactccagatactcagactcaaattaaa
atttgtctttgtgttactttaactcaaggatatggccttaccgaaagtacttcttgtgct
acagttatggataaagatgatacaagtatcggaagagtaggaggaccaactacaatttgt
gatattcgtttagtaaattgggaagatgctggttatagagttacagatgttccatatcct
agaggagaaatcataattgggggtgaaaatatttcagctggttactataagttattagat
aaaacaaaagaagacttttttcaagaagatggaaaacgatggttcagaactggtgatatt
ggagaaattcatgaagatggttgtataaaaattatagatcgaaaaaaggatttggttaaa
ttacaatttggtgaatatgtttctttgggcaaaatcgaagcagaattaaaaacatgtcct
attgtagaaaacatttgtgtttatggagactcgtataaaactttcacagtagcactaata
gtgcccaatgcattctatctagaacaaattgctaggaatataggaattaatggaaaaaat
tttgaggaactttgcaatgatccacaaattgaaaaagcagtgttacaggaattgattgaa
caagctaaaaaatgtaagctccagagatatgaaataccagctgctataaaactctgttca
gaacaatggtcacctgacatgggattggtaaccgctgcatttaagcttaaaagaaaagca
gttcaagagcgttatcaacatgaaatcaacagaatgtatgcctcgtga

DBGET integrated database retrieval system