KEGG   Apis mellifera (honey bee): 409693
Entry
409693            CDS       T01057                                 

Definition
(RefSeq) inositol monophosphatase 1
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00562  Inositol phosphate metabolism
ame01100  Metabolic pathways
ame04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    409693
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    409693
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     409693
SSDB
Motif
Pfam: Inositol_P
Other DBs
NCBI-GeneID: 409693
NCBI-ProteinID: XP_393191
BEEBASE: GB46291
UniProt: A0A088A4S7
AA seq 272 aa
MSNTDKYYTVVLRLVLEAGSIVREKINQPKDAMTKSCEVDLVTEWDQNVEKLLMEGISSK
FPDHKFIGEEASSLGSKIELTEAPTWIIDPIDGTMNFVHGLPHTCISIALLINKIIEIGV
VYNPILDQLFTARKGQGAFLNGRPLHVSGQKELRKALIMMEMGTSRDPEKMKIVLENANI
LAPHVHGIRALGSAALNMCMVALGGADISFEFGIHAWDVAAGDIIVREAGGVCIDPAGGP
FDVMSRRVLCASTMELAQKLAKILVQYYPERD
NT seq 819 nt   +upstreamnt  +downstreamnt
atgtcgaatactgacaaatattacacagtcgttcttcgattagttttagaagctggttcg
attgtgagagaaaaaattaatcaacctaaagatgcaatgacaaaatcctgcgaagtcgat
cttgttaccgaatgggatcaaaatgtcgagaaattattaatggaaggaatatcttctaaa
tttccggatcataaatttattggcgaagaagctagttcacttggtagtaaaatagaactt
acagaagcaccgacatggatcattgatccaatcgatggcacaatgaatttcgtgcatggt
ttgcctcatacttgtatatcaattgcattacttattaataaaattatcgaaattggtgta
gtttataatccaattttggatcaactttttactgcccgtaagggtcaaggtgcattccta
aatggacgtcctcttcatgtctctggacagaaagaattacgtaaagctcttataatgatg
gaaatgggtacaagtagagatccagaaaaaatgaaaattgtattggaaaatgcaaatatt
cttgctccacacgttcatgggatacgagctttgggatctgcggctttaaatatgtgtatg
gttgctttgggtggagcggatatttctttcgaatttggtattcatgcatgggatgtcgca
gctggtgatatcattgtaagagaagctggtggagtatgcatagatccagcaggtgggcca
tttgacgtcatgagcagaagagttttgtgtgcatcaacaatggaattagcacaaaaatta
gctaaaatattagttcagtattatcccgaacgagattaa

DBGET integrated database retrieval system