KEGG   Apis mellifera (honey bee): 409709Help
Entry
409709            CDS       T01057                                 

Definition
(RefSeq) putative glucosylceramidase 4
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00511  Other glycan degradation
ame00600  Sphingolipid metabolism
ame01100  Metabolic pathways
ame04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    409709
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    409709
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    409709
Enzymes [BR:ame01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     409709
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Motif
Other DBs
NCBI-GeneID: 409709
NCBI-ProteinID: XP_393208
BEEBASE: GB53579
UniProt: A0A088APM5
AA seq 511 aa AA seqDB search
MNTKHWAKLLFLISFFFRKSIANDCAPYRVDNEIIACVCNATYCDGIPDNIPEVPTEGNS
YWYVSNKQGLRMNVSEVKFDRCENFVADTTITVDSKKKYQKIIGFGGAFTDATGINIAKL
SRATQEQLIRAYYDPKKGSRYTLGRIPIGSTDFSTRIYTYDDAPGDKLLKNFSLAPEDYN
YKIPYVKLAVELNPEVLLFAAAWTAPLWMKQFDNNITYLKEEHYETYVNYLIKFLDKYER
NGVNIWGITPSNEPLLGFMIDNPNISMTWIPKTQANWIANYFGPILASSPFNKTLLLTYD
DNRIKAIEYVKAAIEIGGKYIAGIGIHWYKDSTYPATIIDRIHEKYPDKFILMTEASIFN
PIWNCSSKLKSEAWQRGEKYILSIIDYMNHWSVGWVDWNMVLDKTGGPTVVNNNLDAPII
VNPETDEFYKQPLYYAIKHVSRFVDRDSFRISIIDNNSINSTAFLTPSGETVVVLYNGAT
STKHIILKDLQKDSKLCLELSPQSMNTLKYK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgaaacactgggctaaacttctattcctaatttcttttttcttcagaaaaagt
atcgcaaacgattgtgcaccttaccgtgtagataatgaaataatcgcgtgtgtctgcaat
gcgacatattgcgacggtataccggataatattccggaagtacctacggaaggtaattcc
tattggtacgtgtcaaataagcaagggctgcgaatgaacgtgtcagaagtaaagtttgac
aggtgtgagaactttgtcgcggatacaacaatcaccgtagacagtaagaaaaaatatcaa
aaaataattgggtttggaggcgcgtttaccgatgccactggtataaacatagcgaaactc
agtcgagctactcaggaacaactgattcgtgcgtattacgatccgaaaaaaggaagcaga
tatacattgggccgtatacctattggttccaccgatttttctacgagaatttacacgtac
gacgatgctcccggtgataaattgttaaaaaacttttcccttgcaccggaagattacaat
tacaagataccatatgtaaaattagctgttgaattaaatcctgaagtactattgttcgca
gcagcatggactgccccattgtggatgaaacaattcgacaacaatatcacttatttgaaa
gaagaacactatgaaacctacgttaattatttgattaaatttttggataaatatgaaaga
aacggtgttaatatatggggaattacacctagcaatgaaccgttgctcggttttatgatc
gataatccaaatatttctatgacatggatacccaaaacacaagctaattggattgctaat
tatttcggcccgattttggcatcatcaccatttaataaaacgttacttttaacttatgac
gataatagaatcaaagcaatcgaatatgtcaaagcagcgatcgagattggaggaaaatat
attgctggaataggtatacattggtataaagattctacttatcctgcaactatcatagat
cgtatacacgagaaatatcctgacaaatttattcttatgactgaagcatccatatttaat
ccaatatggaactgtagcagtaaacttaaatcagaagcatggcaaagaggcgaaaaatat
attttaagcataatagattatatgaatcattggtcagttggatgggtagattggaatatg
gttctggataaaactggtggaccaaccgttgttaataacaatctcgacgctcctattatc
gtaaatccagaaaccgatgaattttataaacaacctttgtattatgctatcaaacacgtt
agcagattcgttgatagagattctttccgaatttctattattgataataattcgatcaat
tctacagcctttcttacaccgtcgggagaaacggttgttgtattatataatggggctact
tctacaaaacatataattctaaaggatttgcaaaaagatagtaaactttgcttggaatta
tctccgcaatctatgaacactttaaaatataaataa

DBGET integrated database retrieval system