KEGG   Apis mellifera (honey bee): 409906
Entry
409906            CDS       T01057                                 
Name
(RefSeq) transcription initiation factor TFIID subunit 2
  KO
K03128  transcription initiation factor TFIID subunit 2
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    409906
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ame01002]
    409906
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ame03021]
    409906
   03036 Chromosome and associated proteins [BR:ame03036]
    409906
Peptidases and inhibitors [BR:ame01002]
 Metallo peptidases
  Family M1
   409906
Transcription machinery [BR:ame03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     409906
   Coactivators
    SAGA/TFTC/STAGA complex
     409906
Chromosome and associated proteins [BR:ame03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     409906
SSDB
Motif
Pfam: Peptidase_M1 HEAT_2 Mcl1_mid AAA_11 Macoilin
Other DBs
NCBI-GeneID: 409906
NCBI-ProteinID: XP_393397
BEEBASE: GB53825
UniProt: A0A8B9B3Y6 A0A7M7R425
Position
LG3:9848226..9853911
AA seq 1199 aa
MKKEKTADNSRPYKLAHQILSLTGISFQRKSIIGFVELTIVPLRDTLRLVKLNAKQCRIY
RVCLNDTYEAPFQYFDPFLDICQGDGKQRSLEFFSNMHLAAAQRVDPDNNAGELVVQIPP
DAAHLVAEGRSLRISIEFSLEQPQGGVHFVVPNCEGTLAERGAHMYTYSYENSSRLWFPC
VDSFAEPCTWKLEFTVDDSMTAVSCGDLVEVVYTPDMRRKTFHYVLNTPACAPNIALAVG
PFEIFVDPYMHEVTHFCLPQLLPSLKVSAKYMHEAFEFYEETLSNRYPYSCYKQVFVDEL
DEDINAYATMSILNTNLLHSTAIIDQVYITKKAMAQAVAEQFFGCFISMQNWSDTWLPKG
ISTYLTGLYAKKCFGNNEYREWIQSELQEVVKYEEQFGGIILDPSQPPAPLPIAANTPAP
TPRAPDPGFYFPIRNLHTMSPKYIEVLRKKAHLVIRMLEHRIGQELLLQVFNKQLSLAAN
AAQQKIDSGLWSHMLISTNVFTKAIFTVTGKDMAVFIDQWVRTGGHAKFSLSFIFNRKRN
TVELEIRQETTNQRGIRKYVGPLLVNIQELDGTFKHTLQIEGTVAKADITCHSKSRRNKK
KKIPLCTGEEVDMDLSAMDDSPVLWIRLDPEMTLLRAVQVEQPDYQWQYQLRHERDVTAQ
LEAIEALQNHATPATRLALTDTIENEHCYYKVRLRAAHCLTKVANAMVATWAGPPAMLAI
FRKLFGSASCRRIIKQNNFTNFQHYFLQKTIPVAMAGLRNAHGICPPEVLAFLMDLFKYN
DNSKNRYSDNYYRAALIEALGATVTPVISVQQGTAITAESLSVDTRAILEEVTRNLNLEK
LLPCYKYTVSVSCLKVIRILQKFGHLPSNPHLFRAYAAYGQFIDVRIAALEALVDFTRVD
GKWEDLEFLLDMIEMDPHPGVRHRLVRLMVENPPFERAHKHRLDRPELVDRIWNLINGML
SHDPKIRCDLVDLYYTLYGSKRPFCLPIPELAAITKPRKGPSSPEQDIKPNISHIKHESS
VMETENSSGVGKKKLSPNTDIPGPSNSVDYTPEMKRQKMDDRTPSVTSDGKVKSEYYSDN
SASLPGIMGTPGPVGFEPGMFKKEEEHKQKSDSVNKNKKKKKDKKKHKHKHKHKHDHKHG
KDKEKKEKDKEKVKEKEKDKEKDKTKDSSNLKIKEETLSSASSSLSPDATTVTNEFIFP
NT seq 3600 nt   +upstreamnt  +downstreamnt
atgaagaaagaaaaaacggccgataatagtcgaccatataaattggctcatcaaattttg
agtctcacaggtataagtttccaaagaaagagtattattggatttgtagaattaacaatt
gttccacttagagatacattaagacttgtgaaactaaatgcaaaacaatgtagaatttat
agagtatgtttaaatgatacttatgaagcaccatttcaatattttgatccatttttagat
atttgccaaggagatggcaaacaacgatcattagaatttttttcaaatatgcatttagca
gctgcacaaagagttgatccagataataatgcaggagaattagttgtacaaattcctcca
gatgctgcacatttagttgctgagggtagaagtttaagaattagcattgaattctcttta
gagcaacctcaaggtggagtccattttgttgtaccaaattgtgaaggaacattagcagag
agaggtgctcatatgtatacatatagttatgagaattcttcaagattatggtttccatgt
gttgatagctttgcagaaccatgtacttggaaattagaatttactgtagatgattctatg
actgctgtatcttgtggtgatcttgtagaagttgtatatactccagatatgcgtagaaaa
acttttcattatgttcttaatacaccagcatgtgcaccaaatattgcacttgcagttgga
ccatttgaaatatttgttgatccatatatgcatgaagtaacacatttttgtttgccacaa
ttactaccatctttaaaagtttctgcaaaatatatgcatgaagcttttgaattttatgaa
gaaacattgtcaaatagatatccttattcttgttataaacaagtttttgtagatgaatta
gatgaagatataaatgcttatgctactatgagtattttaaatacaaatttattacattca
actgcaattattgatcaagtctatattacaaaaaaagctatggcacaagctgttgcagaa
caattttttggttgttttatatccatgcaaaattggtctgacacatggttacctaaaggt
atttcaacctatcttactggtttatatgcaaaaaaatgttttggaaataatgaatataga
gaatggatacaatcggaattgcaagaagttgtaaaatatgaagaacaatttggaggtata
atattagatccttctcaaccaccagctcctttaccaattgcagcaaatacaccagcacct
acacctagagctccagatcctggattttattttccaataagaaatttacatacaatgtct
ccaaagtatattgaagtacttcgtaaaaaagcacatttagttattagaatgttagaacat
cgaattggacaagaattacttttacaagtttttaacaaacaattatctcttgctgccaat
gctgcacaacaaaaaattgattcaggactttggtctcatatgttaattagtacaaacgta
tttacaaaagcaatttttactgtaactggtaaagatatggctgtttttatagatcagtgg
gttagaacaggtggacatgcaaaatttagtttaagttttatatttaatagaaaaaggaat
actgtagaattagaaattcgacaagaaactacaaatcaaagaggaattaggaaatatgtc
ggtccacttctagttaatattcaagaattagatggtacttttaaacatactttacaaatt
gaaggtactgtggcgaaagcagacataacatgtcacagtaaaagtcgtagaaataaaaag
aaaaaaattccactgtgtacaggagaagaagtagatatggatctttctgctatggatgat
tctcccgtgttatggataagattagatcctgaaatgacacttttacgtgctgttcaagtt
gaacaacctgattatcaatggcaatatcaattaagacatgaaagagatgttacagcacaa
ttagaagctattgaagctttacaaaatcacgcaacacctgctacacgattagcactaact
gatactatagaaaatgaacattgttattataaagttagattacgagctgcacattgttta
acaaaggtagctaatgcaatggttgcaacatgggcaggtccaccagcaatgttagctata
tttcgaaaattatttggatcggcttcgtgtagacgaataattaaacaaaataattttaca
aattttcaacactattttttacaaaaaactataccagtagcaatggctggtttacgtaat
gctcatggtatatgtccaccagaagttttagcttttttaatggatttatttaaatataat
gataatagtaaaaacagatattcagataattattatagagctgcactaattgaggctctt
ggagctactgttacacctgtaattagcgtgcaacaaggaacagctattactgccgaatct
ttatcagttgatactagagctatattagaagaagttacacgaaatttaaatttggaaaaa
ttattaccatgttataaatacacagtcagtgtttcttgtcttaaagttatacgtatttta
caaaagtttggccatcttcctagcaatcctcatcttttcagagcatatgctgcatatgga
caatttatcgatgttagaattgcagctttagaagcattagttgattttactagagtagat
ggcaaatgggaagatttagaatttttattagatatgatagaaatggaccctcatcctgga
gtacgacatagattagttagacttatggttgaaaatccaccatttgaaagagcgcataag
catcgtttagatcgtcctgaattggtcgatcgtatatggaatttaattaatggtatgctc
tctcatgatcctaaaattcgatgcgacttagttgatttatattatactttgtatggatca
aaacgaccattttgtcttcctattcctgaacttgctgctattactaaaccaagaaaagga
ccttcaagtccagaacaagatattaaaccaaacatatcgcatataaaacatgaatcatca
gtaatggaaactgaaaattcaagtggagtaggtaaaaaaaaactttctccaaatacagat
attccaggcccttccaattcggtagattatactccagaaatgaagcgtcaaaaaatggat
gatcggactccttctgtaaccagtgatggaaaagtaaaatcagaatattatagtgataat
tctgcatcattacctggtattatgggaacaccaggaccagtaggttttgaaccaggaatg
tttaaaaaagaagaagaacataaacaaaaaagtgattctgttaataagaataagaaaaag
aaaaaagataaaaagaaacacaagcataaacacaaacataaacatgaccataaacatggt
aaagataaagagaaaaaggagaaagataaagagaaagttaaagagaaggagaaagataaa
gaaaaagataaaactaaagattcttcaaatttaaaaatcaaagaagaaactttaagctca
gcaagttccagtcttagtccagatgcaacaactgttactaacgaatttatttttccataa

DBGET integrated database retrieval system