KEGG   Apis mellifera (honey bee): 410026
Entry
410026            CDS       T01057                                 
Name
(RefSeq) 26S proteasome regulatory subunit 6B
  KO
K03063  26S proteasome regulatory subunit T3
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03050  Proteasome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    410026
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ame03051]
    410026
Proteasome [BR:ame03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     410026
SSDB
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_2 AAA_5 AAA_16 DUF815 RuvB_N RNA_helicase AAA_22 AAA_18 NTPase_1 AAA_28 Mg_chelatase AAA_33 AAA_14 TIP49 AAA_7 NACHT TsaE ATPase_2 Zeta_toxin IstB_IS21 AAA_17 AAA_3 Sigma54_activat TniB AAA_24 AAA_25 Peptidase_S49_N NB-ARC ABC_tran AAA_30 Viral_helicase1
Other DBs
NCBI-GeneID: 410026
NCBI-ProteinID: XP_003251449
BEEBASE: GB41363
UniProt: A0A7M7GBG3 A0A8B6XW36
Position
LG5:complement(12727989..12730021)
AA seq 415 aa
MDDMGIILPDKDVGEMECKPVIGHYTGAGDELDVEDLYTKYKKLQRMLEFLEVQEEYIKD
EQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDREL
LKPSASVALHKHSNALVDVLPPEADSSISMLQADEKPDIQYSDIGGMDMQKQEIREAVEL
PLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVARHTTAAFIRVVGSEFVQKYLGEG
PRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTT
NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITAKMNLSEEVDLEDY
VARPDRISGADINAICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDESEHEFYK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggatgatatgggtattattctacccgataaggatgttggagaaatggaatgcaaacct
gtaattggacactatacaggtgctggtgatgaattggatgttgaagatctttataccaag
tataaaaaattacaaagaatgttagaatttcttgaagttcaagaagaatatatcaaagat
gaacaacgtaatctgaaaaaagaatatttacatgctcaagaagaagtaaaacgcatacaa
agtgtacctttagttattggacaattcttagaagctgtagaccaaaatactggtattgta
ggttctactacaggttcaaattattatgtacggattttatctacaattgacagagaatta
ttaaaaccatctgctagtgtagctctacataaacatagtaatgctttagtagatgtttta
ccaccagaagctgattcaagtatttcaatgttacaagcagatgaaaaaccagatattcaa
tatagcgatattggtggtatggatatgcaaaaacaagagattagagaagcagtagaacta
cctttaactcattttgagttgtataagcaaattggaattgatccaccaaggggtgtgtta
atgtatggtccccctggatgtggtaaaaccatgcttgcaaaagctgtagctagacatact
actgctgcatttattcgtgtagtaggatcagaatttgtacagaaatatttaggtgaaggg
ccaagaatggtgagagatgtcttccgtttagctaaagaaaattcaccagctataattttt
gttgatgaaatcgatgctatagctacaaaaagatttgacgctcagactggtgctgatcgt
gaagtgcaacgtattcttttggaattgcttaatcaaatggatggttttgatcaaactact
aatgttaaagttataatggcaacgaatagagctgatacattagatcctgcattattacgt
cctggcagattagatagaaaaattgaatttcctttgcctgatcgccgtcaaaaacgtcta
attttttcaacaattactgcaaaaatgaatttaagtgaagaggtagatcttgaagattat
gttgcgcgaccagatagaatttctggcgctgatattaatgcaatttgccaagaagcagga
atgcatgcggttcgtgagaatcgatacatagtcttagcaaaagattttgaaaagggttat
aagaataatattaaaaaggatgaatctgaacatgaattctacaagtaa

DBGET integrated database retrieval system