KEGG   Apis mellifera (honey bee): 410040
Entry
410040            CDS       T01057                                 
Name
(RefSeq) serine/arginine-rich splicing factor 1B
  KO
K12890  serine/arginine-rich splicing factor 1
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    410040
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ame03041]
    410040
Spliceosome [BR:ame03041]
 Common components
  Common spliceosomal components
   SR proteins
    410040
SSDB
Motif
Pfam: RRM_1 RRM_3 RRM_7
Other DBs
NCBI-GeneID: 410040
NCBI-ProteinID: XP_006559268
BEEBASE: GB54451
UniProt: A0A7M7MUY5
Position
LG15:2612739..2646477
AA seq 248 aa
MSHGGRNECRIYVGNLPPDIRTKDIQDLFYKFGKVIFVDLKNRRGPPFAFVEFDDPRDAE
DAVHARDGYDYDGYRLRVEFPRGGGPSNNFRGGRGAGDSGRGGRGEMSNSRGRGPPARRS
QYRVLVTGLPPSGSWQDLKDHMREAGDVCFADVFKDGTGVVEFLRYEDMKYAVKKLDDSR
FRSHEGEVAYIRVKEDHNSGDRGRSEDRERGRSHSRSYSPRRRGSPTYSPLRRNYSRSRS
RSRSRSYD
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtctcacggtggtagaaatgaatgtagaatttatgtaggcaatttacctcccgatatt
agaacgaaagacattcaagatcttttttataagttcggtaaagttatttttgttgattta
aaaaatcgtagaggaccaccttttgctttcgtcgaatttgatgatccaagagatgctgag
gatgcagtacatgcaagagatggatatgattatgatggttatagactacgtgtagagttt
ccaagaggtggaggtcctagtaataattttcgtggtggtcgtggagcaggagatagtgga
agaggtggtcgaggtgaaatgagtaattctcgaggacgtggaccacctgcaagaagatct
caatatagagttcttgttacgggtctgcctccttctggtagttggcaagatttaaaggat
catatgcgtgaagctggtgatgtttgctttgctgatgtttttaaagatggtactggagtt
gtagaattcttacgatatgaagatatgaagtatgctgtaaagaaattagatgattcaaga
tttaggtctcatgagggtgaagtagcatatattcgagtgaaagaagatcataacagtggc
gataggggacgcagtgaagatagggaaagaggtcgaagtcattcacgaagctatagtcca
cggcgtcgtggctcacctacctattcaccattgcgacgtaattactcgcgatcaagatct
cgctccagatctcgttcatacgactag

DBGET integrated database retrieval system