KEGG   Apis mellifera (honey bee): 410076
Entry
410076            CDS       T01057                                 
Name
(RefSeq) probable uridine-cytidine kinase isoform X2
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00240  Pyrimidine metabolism
ame00983  Drug metabolism - other enzymes
ame01100  Metabolic pathways
ame01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    410076
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    410076
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine/cytidine kinase
     410076
SSDB
Motif
Pfam: PRK CoaE AAA_18 Zeta_toxin Cytidylate_kin AAA_17 AAA_33 NB-ARC SpoIVA_ATPase AAA_22 T2SSE WHIM1
Other DBs
NCBI-GeneID: 410076
NCBI-ProteinID: XP_006558473
BEEBASE: GB49112
UniProt: A0A7M7LLZ9
Position
LG3:complement(3237388..3240227)
AA seq 265 aa
MADMSMNIVTPRKMSFGINGKLNGLESKTPFLIGVSGGTASGKSTVCKRIMEKLGQVDMD
HMQRQVVCISQDSFYRDLSPAEKLKAEKGQYNFDHPDAFDNDLILQTLQDILAGVKCEIP
AYDYRSNSLMKDQITTIYPADVVLFEGILVFYFPKIRDLFHMKLFVDTDSDTRLARRVPR
DIKERGRDLDYVLNQYMNFVKPAFEEFCLPTKKFADVIIPRGADNTVAIDLIVQHIRDFL
SNRGRVTIQPESSVNRTEKLSKRPH
NT seq 798 nt   +upstreamnt  +downstreamnt
atggcagatatgtcaatgaatattgttactccgcgaaaaatgtcttttggtattaatgga
aagttaaacggtttagaaagtaaaacaccttttttaattggagtttcaggtggtactgcc
agtgggaaatcaactgtatgtaaacgtataatggaaaaattaggacaagtagatatggat
catatgcaacgacaagtagtttgtatttcacaagatagtttttatcgagatttatcacca
gctgaaaaacttaaagctgaaaagggtcaatataattttgatcatccagatgcatttgat
aatgacttgatacttcaaacattacaagatatattagctggtgtaaaatgtgaaatacca
gcctatgattatagaagtaacagtttaatgaaagatcaaattacaacaatttatcctgct
gatgttgttttatttgaaggtattttagtgttttattttcctaagatacgagacttattt
catatgaaattatttgtggatactgactcagatactagattagctagaagagtaccaaga
gacataaaagaaagaggaagagacttagattatgtattgaatcaatacatgaattttgta
aaacctgcatttgaagaattctgtcttcctactaaaaagtttgctgatgttattatacca
agaggtgcagacaatacagtggcaatagatttgatagtgcaacatataagagacttctta
agcaacagaggtagagttacaatccaacctgaaagttcagtaaacaggacagaaaaatta
tctaagaggccacattaa

DBGET integrated database retrieval system