KEGG   Apis mellifera (honey bee): 410118
Entry
410118            CDS       T01057                                 
Name
(RefSeq) D-glucuronyl C5-epimerase B
  KO
K01793  heparosan-N-sulfate-glucuronate 5-epimerase [EC:5.1.3.17]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    410118
Enzymes [BR:ame01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.17  heparosan-N-sulfate-glucuronate 5-epimerase
     410118
SSDB
Motif
Pfam: C5-epim_C
Other DBs
NCBI-GeneID: 410118
NCBI-ProteinID: XP_006563368
BEEBASE: GB49827
UniProt: A0A7M7GQ58
Position
LG11:complement(8078510..8081300)
AA seq 566 aa
MMRLNFKTVLLVIVVAVLSSILTSWNNCGSPSFFKNTDWKSKFQHKDRLNLETGYQEIDC
HINGDYSIGCRKEGDEVYIPFSFIHKYFEIYGKLATYDGLERFEWLHSYSKIVNPKGKYD
PRGVFMTFENYNVEVRERVKCISGNDGVPISTQWESQGYYYPTQIAQFGLSHYSKNLTEP
EPHRKIIEDSDKVKREWIIPQGSIASRIFDKYVNSYVMKFATPETSTSGITLKLDHVLDF
VLKWDFNIKDNGSIMITLQSRERKEIYYLHYITSNIVLHTYNNHVYYGIGQINHQWRRFT
RDLVIDLQKGLYLNDKNKKKMSRSKLKIVKITLYGSGMIDNVTLSTSEHMEQFYDAARWF
VSNQNITSGGWANPVRRKVATGMATLEPGWYSSMGQGHAISVLARAYYHSGEEKYLQAAV
RGLQPFKLSSNKGGVAAIFLNKYVWYEEYPTTPSSFILNGFIYSLIGLYDLKSIAAGKDA
EEASRLFNQGMTSLKNMLTLYDTGSGTTYDLRHFTLKTAPNLARWDYHSTHINQLLLLNS
IDNDSIFTTTAERWIGYMNGKRAAHN
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgatgaggttgaatttcaaaacagtattacttgtaatagtagttgcagtgttaagttca
atattaacatcttggaacaattgtggtagtccatcattttttaaaaatactgattggaaa
tcaaaatttcaacataaagatcgattaaacttagaaactggatatcaagaaatagattgt
cacataaatggtgattattctattggatgtcgtaaagaaggagatgaagtttatatacca
ttctcatttattcataaatattttgagatttatggaaagttagctacttatgatggttta
gaaagatttgaatggctgcatagttattctaagattgttaatcctaaaggaaaatatgat
cctagaggagtgtttatgacctttgagaattataatgttgaagttcgagaacgtgtcaaa
tgcatcagtggaaatgatggagtaccaatatctactcaatgggagagtcaaggatattat
tatcctactcaaattgctcaatttggattatcacattatagtaaaaatttaacagaacca
gaacctcacagaaagataattgaagattcagataaagttaaaagagaatggattatacct
caaggatctattgcatctagaatatttgataaatatgttaatagttatgtaatgaaattt
gcaacaccagaaactagtacttctggtattactttaaaattagatcatgtgctagatttt
gtattaaaatgggattttaatattaaagacaatggaagtatcatgattacattgcaatct
agagaaagaaaagaaatatattatcttcattatattactagtaatatagtgttacatact
tataacaatcatgtgtattatggaattggtcaaattaatcatcagtggagaagattcact
agagacttagttatagatttacaaaaaggtttatatttaaatgataaaaataaaaagaaa
atgtctcgttcaaaattgaagattgtgaaaataacattatatggatcaggaatgattgat
aatgtaacattatctacaagtgaacatatggaacaattttatgatgcagctagatggttt
gttagtaatcaaaatattacttctggtggttgggcaaatcctgtacgaagaaaagtagct
actggaatggctactcttgaacctggatggtattctagtatgggtcaaggccatgcaatt
tctgtattagcaagagcatattatcattctggtgaagaaaaatatttacaagctgctgtt
agaggtcttcaaccttttaaattatcatctaataaaggaggagtagctgcaatattttta
aataaatatgtgtggtatgaagaatatcctacaacaccttcttcatttatacttaatgga
tttatttattctttaattggtttatatgatttaaaaagcatagcggcaggtaaagatgcg
gaagaagcatcccgcctttttaatcagggtatgacatccctgaaaaacatgttaacatta
tatgatacaggttctggtactacatatgatttacgtcattttacattaaaaactgctcca
aatttagctagatgggattatcattctactcatattaatcaacttcttcttttaaattca
attgacaatgattcaatttttactactacagcagaacgttggataggttacatgaatggt
aagagagctgcacataattga

DBGET integrated database retrieval system