KEGG   Apis mellifera (honey bee): 410256
Entry
410256            CDS       T01057                                 

Definition
(RefSeq) protein lap1
Organism
ame  Apis mellifera (honey bee)
SSDB
Motif
Pfam: LRR_8 LRR_4 PDZ PDZ_6 PDZ_2
Other DBs
NCBI-GeneID: 410256
NCBI-ProteinID: XP_006566575
BEEBASE: GB45195
AA seq 1026 aa
MGSAWWQCAACLRTQEEDICELHLNNCNLYDVPPDVFIYERTLEKLYLDANRIKDLPRPL
FQCHELRVLSLSDNEVTTLPPAIASLINLEYLDLSKNSIKELPDSIKECKNLRSIDISVN
PFERFPDAITHIVGLRELYINDAYIEYLPANFGRLSALKTLELRENNLMTLPKSMSRLIN
LQRLDIGNNDFTELPEVVGDLINLTELWIDGNDIRRIPLNINQLYRLNHFDCTMNAIHII
PSEVEGWRDISIMHLSSNEIYQLPDSLCYLRTIVTLKVDDNQLNALPNDIGQMSNLEELI
VTKNFLEYLPSSIGLLRKLHCLNVDNNYLRCLPPEIGSCTALSLLSLRSNNLTRVPPELG
HLSSLKVLNLVNNCIKFLPVSMLNLSNLKALWLSDNQSQPLVPLQQEFNCEEDMMVLSCF
MLPQKPRQELEQITPAVGLISSSIVGTGKRICFAAEVESEIPRQLHRAPTPYPKELRNLA
RHARNLHHQSAHDERMHLEQETMIKEAIIATTTLDLTSKSGTCFSQSLFNKGSHSSLSPT
EHHISKECKTNTPTDIGTEQSVSEESSDEANKTVLAKEKSPDIREAKYIRNPTSEYISKP
PTVADYVNSTWKPDEYSKANTAKIIESEKFIEPYKSMPIIISNKNTDHVQVPKVNEVPLV
PPPYHIAAAFSKKAALFQQLNQSAQLDLSPPQIDINTSNLKISQETQIQNYEEQYNDKFS
SNNTDVPNKTNNDEKINSFSNIDQTHILTESIDPEQSLEGDRSLKPSRIPILKTKHLENT
NSISSNDLSNKCINSSVEDYEALKILNASCIPTSPITGKKYRSPLSMQHKVSDRSKKIIN
GTSNNNASCDNLSMNTTLVTNPNMEGTSKTLSIETSLNMNNSVNIKNETNSGRSTPILSN
NKFSNEVTNSNVDKYKIVGRNESLNPERKPRFKWMFGPHKNANVLPVQVKKNPGLGFSIA
GGVAGAETGIIVTKVNPDGPAQGTLRPGDKILEVDGIDFTKSDHNNAVAVLRATGAVVSM
MISRHQ
NT seq 3081 nt   +upstreamnt  +downstreamnt
atgggtagtgcttggtggcagtgtgctgcatgtttaagaacacaagaagaagatatctgt
gaattgcacttaaataattgtaatctttatgatgtaccacctgatgtgttcatttatgag
agaacattggaaaaactctatcttgatgccaataggataaaggatcttccaagaccatta
tttcagtgccatgaattacgagtactttccctcagtgataatgaagtcacaacgttacca
cccgccatagcatcattaattaacttggaatatttagacctcagtaaaaatagtattaaa
gaactaccagacagtataaaagaatgtaaaaatcttcgttctatagatatcagtgttaat
ccatttgaacgtttcccagatgctattacacatattgttggattaagagaattgtatata
aatgatgcatacatagaatatttaccagcaaattttggaagactttcagctttgaaaaca
ttagaacttagggaaaataatttgatgacattaccaaagagtatgagtcgtttaataaat
ttgcaaagacttgatattggtaataatgatttcacggaattgcctgaagttgttggggat
cttatcaatctcactgaattgtggatagatggtaatgatatcagacgtataccactcaac
attaatcagctttaccgtttaaatcattttgattgtaccatgaatgcaattcatattatt
ccatcagaagtagaaggatggagagatatttccattatgcatctgtcatcaaatgaaatc
tatcaattaccagattctctttgttatttacgtacaattgtgactcttaaagttgatgac
aatcaattgaatgcactgccaaatgacattggacaaatgtcaaacttagaggagcttata
gttactaagaacttcctcgaatatttgccatcatcaataggacttttgcgaaaattacat
tgtttaaatgtagacaataattatttgagatgccttccaccagaaattggaagttgtacg
gcgttatcattgttgtcattgagatcaaacaatttaactcgagttccacctgaattggga
catttatcttctttaaaagtactcaatcttgtaaacaattgcattaaatttttgcccgtt
tctatgttaaacttgagcaatttaaaagcattatggctgagcgacaatcaaagtcaacca
ttagtgccattgcaacaagaatttaattgtgaagaagacatgatggtgttaagttgcttt
atgctaccacaaaaaccgcggcaagaacttgagcaaataacaccagctgtaggattaatt
tcgagttcaattgttggtactggaaaaagaatatgttttgctgctgaagtagaatctgag
atccctagacaacttcaccgagcaccaactccttatcctaaagagctgcgcaaccttgct
agacatgcccgcaatttacatcatcaatcagcacatgatgaaagaatgcatttagaacag
gagactatgatcaaagaagctattattgctacaactactttggaccttacctcaaaatct
gggacctgtttttcacaaagtttatttaataagggttcacattcatcattatcaccaact
gaacatcatatatcgaaagagtgcaaaactaatactcctacggatattggaacagaacaa
tctgtttcagaagaatcttccgatgaagcgaacaagacagttcttgcaaaagaaaaaagt
ccagatatcagagaagcaaaatatattcgtaatcctacatctgaatacatttccaaacct
ccaacagtagcagattatgtaaattctacttggaaaccggatgaatattcaaaagcaaat
acagcaaaaattattgaatcagaaaagtttatagaaccttataaaagtatgcctatcatt
ataagcaacaagaatactgatcatgttcaagtaccaaaagtaaatgaagtaccacttgtc
ccaccaccatatcatattgctgctgcattttcaaaaaaagcagcactttttcaacaatta
aatcaatcagcccaattggatttatctcctccacaaattgatattaacacatcaaattta
aaaatatcacaggaaacgcaaatacaaaattatgaagaacaatataatgataaattttca
tcaaataatacagatgtacctaataaaacaaataatgatgaaaagataaattcttttagt
aatattgatcaaacacatatattgacagaatcaatagatccagaacaatctttagaagga
gatagatcattaaagccaagtagaattcctattttaaaaacaaaacatttagaaaatacg
aattctatttcaagtaacgatttatcaaataaatgcataaactcttctgttgaagattat
gaagctttaaaaatattgaacgcatcatgtatacctacatctccgataacaggaaaaaaa
tatcgaagtccgctttctatgcaacacaaagtttcggatcgatcaaaaaaaataataaat
ggaacttcaaataataatgcttcttgtgataatttatctatgaatacaactttagttaca
aatccaaatatggaaggaacttcaaaaactttatctattgaaacatcattaaatatgaat
aattctgtcaatataaaaaatgaaactaattctggtcgaagtactccaattttatcaaat
aataagttttcaaatgaagtgaccaattctaatgttgataaatataagattgttggacgg
aatgaatcattaaatccagaaagaaaaccaagatttaaatggatgttcgggccgcataaa
aacgctaatgttctgcctgtccaagtgaaaaaaaatcctggtcttggttttagtatagca
ggtggagtagcaggagccgaaaccggaattatagtgactaaagtaaatccagatggtcct
gcacaaggtacacttcgaccaggagataaaattttagaagtggatggcattgactttact
aaatctgatcataacaatgctgtggctgttcttcgagcaacaggagcagtggtatccatg
atgattagccgtcatcaatga

DBGET integrated database retrieval system