KEGG   Apis mellifera (honey bee): 410325Help
Entry
410325            CDS       T01057                                 

Definition
(RefSeq) trifunctional enzyme subunit alpha, mitochondrial
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00062  Fatty acid elongation
ame00071  Fatty acid degradation
ame00280  Valine, leucine and isoleucine degradation
ame00310  Lysine degradation
ame00380  Tryptophan metabolism
ame00410  beta-Alanine metabolism
ame00640  Propanoate metabolism
ame00650  Butanoate metabolism
ame01040  Biosynthesis of unsaturated fatty acids
ame01100  Metabolic pathways
ame01200  Carbon metabolism
ame01212  Fatty acid metabolism
Module
ame_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
ame_M00085  Fatty acid biosynthesis, elongation, mitochondria
ame_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    410325
   00650 Butanoate metabolism
    410325
  Lipid metabolism
   00062 Fatty acid elongation
    410325
   00071 Fatty acid degradation
    410325
   01040 Biosynthesis of unsaturated fatty acids
    410325
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    410325
   00310 Lysine degradation
    410325
   00380 Tryptophan metabolism
    410325
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    410325
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     410325
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     410325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 Pyr_redox_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 410325
NCBI-ProteinID: XP_393806
BEEBASE: GB45128
UniProt: A0A088A1M5
Position
LG11
AA seq 764 aa AA seqDB search
MLQYRLLGAFANVSHINKNISTRTALYKSMRGMSLSTNLKHLKYKVVDNVAVLTLDSPGV
KMNILNSEVMYEIDDVLKNIEQNSAVNSIIFISGKPGCFIAGADINMIRSFKTPEDGYKV
AFEAQKIFEKIEKSKKPIVAAIQGSCLGGGLELAMACHYRIAVNDQKTSLGLPEVMLGIL
PGAGGTQRLPQLVSLSNSLNMILTGKQVKAIKAKKIGLVDLLVNCLGCGIGTSEENTMRY
LEETAIKVAQDITNKTLKINRDSKTLSDKFMNYVLHFDFVKDQVFNLAKEKVKQKTGSLY
PAPFKILDVMRISLNKESKLGYEAEAKAFGELGVTPQCKGLTNLFFGQTTCKKNRFGVPK
NAVKKIAVVGAGLMGAGIVQVSIDKDFDVIMKDTNETALYRGVNQVQKGMHAAVKKKKYS
NFQKDRYFSKLDSTLDYSSFKNADIVIEAVFEDITIKHKVIKEIEENTPNYCVLATNTSA
ISINEIAAGSNRPDKIIGMHYFSPVHKMQLLEIITHKGTSTETIKTAVDVGLKQGKTIII
VGDGPGFYTTRILSALLSEAIRLMQEGVDPIYLDNLTKKFGFPVGAATLSDEVGIDVGAH
ISTYLVKELGERFHGGDINILNDMVKAGFLGRKSGKGIYTYETNVKNKNVNLLALDILKK
YKLEPKGNTTIEDRQLRMVSRFVNEAILCLEENILANPLEGDIGAVFGLGFPPFTGGPFR
WVDSYGADNLVRKMEEFQNHYGDAFKPCQTLYDMASNSSKNFYR
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgttacaatacagattattgggtgcttttgcaaatgtttcgcacattaataaaaatata
tcaacacgaacagcattatataaatcaatgagaggaatgagtttatcaacaaatttaaaa
catttaaaatacaaagttgtggataatgtagcagttcttactttagattctccaggagtt
aagatgaatattttaaattcagaagtaatgtatgaaattgatgatgttctaaaaaatata
gaacaaaattctgctgtaaattcaataatttttataagtggaaaaccaggttgttttatt
gctggtgctgatattaatatgatacgttctttcaaaactccagaagatggctataaagta
gcttttgaagcccaaaaaatctttgaaaaaatagagaaaagtaaaaaaccaattgtagct
gcaattcaaggtagttgtttaggaggaggtttggagttggctatggcttgtcattatcga
attgctgtaaatgatcaaaaaactagtttaggtttaccagaagtaatgttaggtatcttg
cctggtgcaggtggtacacaaagattacctcaattagtatcactttctaatagtttaaat
atgattcttactggtaaacaagttaaagcaattaaagctaagaaaataggacttgtagat
cttttagtgaattgtcttggttgtggcattggaacatcagaagaaaatacaatgagatat
ttggaagagactgctattaaagttgcacaagatattacaaataaaaccttaaaaattaat
cgagattctaaaacattaagtgataaatttatgaactatgtattacactttgattttgta
aaggatcaagtatttaatttagcaaaagaaaaagtgaagcagaaaactgggagtttgtat
cctgcaccatttaaaatcttagatgtaatgcgtattagtttaaataaggaatcaaaactt
ggttatgaagcagaagctaaagcttttggtgaattaggagttacacctcagtgtaaaggt
cttacaaatttattctttggacaaactacttgtaaaaaaaatcgttttggagtgccaaaa
aatgctgttaaaaaaattgctgttgttggtgctggccttatgggagcaggtattgttcaa
gtaagcatagataaagattttgatgtaattatgaaagatacaaatgaaactgctttatac
cgtggtgttaatcaagtacagaaaggaatgcatgctgctgtaaaaaaaaaaaaatattct
aactttcagaaagatagatatttttctaaacttgattctacattagattatagttcattt
aaaaatgcagatattgtaattgaagctgtatttgaagatattacaattaaacataaagtt
ataaaagaaattgaggaaaatacaccaaattactgtgtacttgcaacaaatacatcagca
atttctattaatgaaatagctgctggaagtaatcgtccagataaaataattggaatgcat
tatttctctccagtacataaaatgcaattattagaaataataacacataaaggaacatca
actgaaacaattaaaactgcagttgatgtaggcttaaaacaaggaaaaacaattattatt
gttggagatggtcctggattttatacaacaagaatactaagtgctttattatctgaagct
attaggttaatgcaggaaggtgtggatcctatatatttggataatttaactaaaaaattt
ggatttcctgttggagcagctactttatcagatgaagttggaattgatgttggtgctcac
ataagtacataccttgtaaaggaattaggtgaacgttttcatggtggagatataaatata
ctcaatgacatggttaaagctggttttctaggaagaaaatcaggcaaaggaatatataca
tatgaaactaatgttaagaataaaaatgttaatcttttagcattagatattttaaaaaaa
tataaacttgagccaaaaggaaatacaactattgaagatcgtcaattaagaatggtatct
cgttttgttaatgaagcaatactttgtttagaggaaaatattttggctaatccgttggaa
ggtgatataggagctgtttttggattagggtttcctccatttactggtggaccttttcgt
tgggtagattcttatggtgctgataacttagtaagaaagatggaagaatttcaaaatcat
tatggtgatgcatttaaaccatgtcaaacattatatgatatggcatccaattctagtaaa
aatttttatagatag

DBGET integrated database retrieval system