KEGG   Apis mellifera (honey bee): 410415
Entry
410415            CDS       T01057                                 
Name
(RefSeq) ras-related protein M-Ras
  KO
K07831  Ras-related protein M-Ras
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04137  Mitophagy - animal
ame04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:ame00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    410415
   04137 Mitophagy - animal
    410415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ame04031]
    410415
GTP-binding proteins [BR:ame04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    410415
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase FeoB_N MMR_HSR1 Septin CbiA Gtr1_RagA ATP_bind_1 NB-ARC AAA_16 ParA
Other DBs
NCBI-GeneID: 410415
NCBI-ProteinID: XP_006558579
BEEBASE: GB48225
UniProt: A0A7M7GNH5
Position
LG13:3526502..3528042
AA seq 198 aa
MTRPPNNDNLMTFKLVVVGDGGVGKSALTIQFFQKLFVTDYDPTIEDSYIQHTEVDKQWC
ILDVLDTAGQEEFSAMREQYMRKGDGFLLVYSVTDKQSYENIMNFYTQILRVKDRDVYPM
LLVANKVDLVHLRKVTEEQGRELAHRLGIPYIETSAKDPPLNVDAAFHEVVRIIRNQPPA
ELEKNRRKRRRSGKCNLL
NT seq 597 nt   +upstreamnt  +downstreamnt
atgacacgacctcccaataatgacaaccttatgaccttcaaattggtcgtggttggagat
ggaggtgttggaaaaagtgcactcactatacaattctttcaaaaattatttgttactgac
tatgatcctaccattgaggatagttatattcaacatacagaggtagataaacaatggtgc
atcttagatgtgttagatacagctggtcaagaagaattcagtgccatgcgtgaacaatac
atgcgcaagggtgatgggtttctattagtatactctgtgactgataaacaatcttatgaa
aatatcatgaatttttatacccaaatacttagggtaaaagatagagatgtgtatcctatg
cttctggtagccaataaagttgatttggtacatttgagaaaagttacagaggagcaggga
agggaattggctcaccggttgggtataccttatattgaaacttctgccaaagacccgcca
ttaaatgtagatgctgcattccatgaggtcgttcgcattatcagaaatcaacctccagcc
gaattggaaaaaaatcggaggaaacgaagacgttcggggaaatgtaatcttttgtaa

DBGET integrated database retrieval system