KEGG   Apis mellifera (honey bee): 410603
Entry
410603            CDS       T01057                                 
Name
(RefSeq) odorant receptor 49b isoform X1
Organism
ame  Apis mellifera (honey bee)
SSDB
Motif
Pfam: 7tm_6
Other DBs
NCBI-GeneID: 410603
NCBI-ProteinID: XP_016772002
BEEBASE: GB50053
UniProt: A0A7M7IKQ1
Position
LG15:complement(6967145..6969218)
AA seq 395 aa
MAFRYLAASSIQYILDHTCHVFNFSCGMKFSSLCLSMISWDLSIILLQLLMLAILQVELY
LDRSNAENNLDALVLINGGILAVAKVMCFHIRPLGLISNFTSAVKDYNELNSEENRVIVR
RHAYMGRVACASLIFCSYVGSTLFMTVPMLAGDEEEVINVTEESAIKYPMPSENTLTLIN
MPEKMYFVIFIVEYLMLLLTSTGNLGSDSLFFGIAFHLCGQVEILRLEYNKLSNENERAT
KDIILLTKRHIYLLKLSDMLNETISSILIVQLFSSCVLICTTGFEFILALNIGNIVMTIK
TFIVMCVLLIQLFAYSYVGEYLKTQTEDLGNSVYFCTWYNMPKNVTQNIIFIIMRAQHPV
FLTAGKFFVVNMETYMSILKTSMSYLSVLRVMVNS
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggcctttaggtacctggccgcttcaagtattcaatacattctcgatcatacgtgccat
gttttcaacttttcttgtggtatgaagttttcgtcattatgtctctcaatgattagctgg
gatttaagtatcattcttttgcagttgctaatgttagcgatcctgcaagtggaattatat
ttggacagaagcaacgcagaaaataatctagatgctctagtattaatcaatggcggcatt
ttggcagtggcaaaggtaatgtgttttcatatacggcccttaggacttatctccaatttt
acttctgcggttaaggattacaacgaattgaacagcgaagaaaatcgagtgattgtgcgc
cgacacgcttacatgggtagagtagcatgcgctagtttaatattttgctcgtatgtcggc
tccacgcttttcatgactgttcctatgcttgctggagatgaagaagaagtgattaatgta
acggaagaaagtgcaataaaatatcctatgccatctgaaaatacactaacacttataaat
atgccggaaaaaatgtatttcgtgatttttattgtggaatatttaatgttgctacttacg
agtactggaaatttgggtagtgattcattgttttttggtattgcctttcatttgtgcggt
caagtggaaattttgagactagaatataataaattgtcaaacgagaacgaaagagcaacg
aaagatattattttattaactaagaggcatatttacttgttgaaactaagcgacatgttg
aacgaaacaattagctctattttgatcgtacagctattttcaagttgtgtgcttatatgt
acgaccggatttgaatttattctcgctttgaacattggaaatatcgtcatgacaataaaa
acatttatagtaatgtgcgtgctcttgatacaattattcgcatacagttacgtaggtgaa
tatttaaaaactcaaactgaagatcttggtaattcggtgtacttctgtacttggtacaat
atgccaaaaaatgtgacacaaaacattatttttatcattatgagagctcaacatcctgtt
ttcttaacggctgggaaattctttgttgtcaatatggaaacgtatatgagtattttaaaa
acttcgatgtcgtacctttcagttcttcgagtgatggtaaattcttaa

DBGET integrated database retrieval system