KEGG   Apis mellifera (honey bee): 410671
Entry
410671            CDS       T01057                                 
Name
(RefSeq) proto-oncogene tyrosine-protein kinase ROS isoform X2
  KO
K05088  proto-oncogene tyrosine-protein kinase ROS [EC:2.7.10.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:ame00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    410671
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ame01001]
    410671
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     410671
Protein kinases [BR:ame01001]
 Receptor tyrosine kinases (RTK)
  ROS family
   410671
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr fn3 Pkinase Ldl_recept_b APH
Other DBs
NCBI-GeneID: 410671
NCBI-ProteinID: XP_006571430
BEEBASE: GB51619
UniProt: A0A8B6ZDS1
Position
LG1:complement(21701665..21727456)
AA seq 2601 aa
MLATGLCVFLVLALAGSVSTLLPEDFEDRTAPANLQEECASKCPDLDLNQNRTDDSSSEV
GCGVRCKIDQCTKGCGAWQRALDTSCQAVCNGTQELLPPKELYCVLGCHDALNRYFQQLK
AEIGIPPAPALVADSLTATSLRLEWKGIDIERRGGGISYLVQWRYEELAETWQYCRNQSW
GEDDQILVENLQPYTKYRFRVALLLKSSQHNPEPIVSAPSVVIRTLAAGLPTSAPVIVRA
VAVDSCRASVSWEPGPFPNGPLLSYVLRLQGADHSQLKDIPASENTDHYMFQNLEPNKNY
SISVTMRNGVGEGPPAVTYIMTTPEPAVKDTQQPILILGGQHVVTKQNADMLDDPSVVYE
NTSTIRGVAIHVASAQLFISDSLGYVYRTSITKRTIPTVILSPSQVNFKPLSLSVDWLNL
HLYILGEVKHATTVWQIARCNLDGRGLTVAVAGFLTRPTHIEVDPYNGYLFWVTRGGLFR
LDLADISNGVKHEIQPYLILEDADLGAFTVDHTNFRLLVPHHIQNTVISVSLDGREVLNL
RANTQQPKFKNVVSLAMANGLFYWTNGEEVLIEGYHPGQNRYFHNAYPDRSNGSFVSVNV
LMNASQPVPVPVNPPTGVQAVLGVERAKVSWQAPHLLGGQGKGAWQNWSYELEIKDESTG
ETIHQKDIAGSSHTVHNLREKSEYSIKAAAYTSAGRGPWSTEFRGRTLRDGSHASILWSA
NEGLLRSDVTGENIDTLIYKASLKETEVDYHIVDVSWYKDVLYIVGNNSALYRYNITSHQ
KMKMNIHSVGSVAVDWISKKLYWANPKQQIITRANLNGSHQEPMSILAIVKELMIDSLEA
YLYWSTGHAVEVARLNGQDRRYYHSDEIFNGKQVMGLTLDTENRFVYWIVRSYESGSIVY
RAPTSERISMSHKIVPEKISALQHPNMQGPLCYFSEHLLWLQDDRNAVIGDLSGQNTAII
NGITLSGLHMIAIMDPALHQYPKNFTSETVTVLPNAVNYDSIRVEGTWRNFNISWDPVEN
INYGTVFYEVKFADYINTNSNPEITTETSMPYNNSEQILPYSVLEVTVKAFTYWETAHHT
RKILRSPQSVPSQPTNSRAFIEFHKEPLSDNIDIFAIFRWDQPEFTNGLITGYTVQCWFK
EHNVEIQICDQSLIPSTLLEYTVQDLLPNMTYYFQVRAHTKIGAGLYTDVINISTIYENP
VPQLLVATMDAVRISDLDQEVNYTITRHIAVEVTYLATESKIYWINEMRELVTSDLNGSN
ATKMLALNNSALSITVDWVARHLYWSELSYRENGGRIMKLDLTLWQVGILKYESIVTSNR
RIVNLDILPSTGSLYWIETKKDGGIIMQSNLDGTDIQPFFNYIDDCSCPYRPSVSPVMTI
DSTNFQKPVMYWISLEGHLNIADIDGCACNLIASASFNKGLPPKSLTVDKMNIYWSNIAE
DQIYFVNKKYPDDAEIRHFYLPSVRSIKALGKSLQTYPITNCLIPRQGILSYNVEEMKKS
ANSITVRLPEPVPQFGCERYSLPTTLYTIYVSQCLENDPNMCENGDRIKLQTYKKEYEIK
DLKPFTNYGLKLALSNYYANLESMSLEFGSGVVLQTEAGAPTAPENVTVEALTPTLAIVY
WMPPKILNAPAVRYEVHWRLVRLINGARQKGEFIKGTERTTDGRYFTMLEPWLPDQEYLV
FVRAYPTHVNDVYSESSSQVVKMYPEPNNLTLTGVSVNSLNVSWVPTINLMVRYTLEYKD
VAMEDWQVANDFKVDKDKVTYFIKKLQPRTLYKFHLLLRYPNYKKDFVWPTDGRFTFQTL
GDVPSAPGMPTVTKLRNSVYQLNWKPAQAHGSQITLYRVEGMKINEINEQIDSTGNASWK
LYYNGTDNYWIITGDMDDKYRFRVQARNAYGFGGWSRSSPIIDLTEATGGILAAQQHLGL
VLGLSVPVIIIMLICSCYFLCLYRQRKEDKKAVLPPLVSDVELATLREIPRGNFVQSNAL
YASTLQNDSDDSTLPKIRREQITLAKFLGSGAFGEVFQGNAKDLERPGITPVAIKTLRKG
ASAQEKTEFLQEARLMSHFRHKHVLRLLGVCLDTDPPLLVLELMEAGDLLSYLRASRSLQ
PSDSHALRLQDLLAMCEDVARGCRYLEELHFVHRDLACRNCLVSAKDRENRVVKIGDFGL
ARDIYKNDYYRKEGEGLLPVRWMAPESLVDGVFTSQSDVWAFGVLMWEITSLGQQPYPAR
TNIEVLHHVRAGGRLSKPLNCPLALHQLMLRCWSDVDTRPSFKVCLENIVSLRSTIEDAQ
LNPVASYYLSRRGVSNMAYFADENQNHNNSGNSWKSSSSEGSRDMQPFLQNSHNATPTSQ
SGEMPKYLELLADNEDIILKENSTNGYEVPRSIHISDQNLANTNKASTNVDVKSNLHSDA
SQEQKDIISSDIKEQLEKKCDKRSSISSLNLPERKRASITNMTEKCNTLDSSKLTNPTIK
AILKRDSFTSLTDQRKNKRNVTERRGSEISLEGRSSSSLSSNISLAPPTRPSSSLISSQN
VLPLKNCVIGGTGESTDNVAKNTLPKIQRTHSNLQNGKANIPLVINSALLNLLRQTPVVE
DSNNIVTYTNINTDAVRVNGS
NT seq 7806 nt   +upstreamnt  +downstreamnt
atgttagcaacagggttatgtgtatttctggtgttggcgttggcgggaagcgtttcgacg
cttctgccagaagatttcgaagatcggactgctcctgccaatctccaagaagaatgcgcc
tcgaaatgcccggatctcgatttgaatcagaatcgaacggacgattcaagctcggaggta
ggatgcggtgtacgatgcaaaatcgaccaatgcacaaaaggctgtggagcgtggcaacga
gcactcgatacgagttgtcaagctgtttgcaatggaacccaagaattgttaccacccaaa
gaattgtattgtgtcctgggttgtcacgatgccctaaatcgttattttcaacaattaaaa
gcggaaataggtattccaccggcaccagcactggtggccgactcgttgaccgctacttcc
ttgcgtctcgaatggaaaggaatagacatcgaaagacgcggcggaggcatttcgtactta
gtgcaatggaggtacgaagaattggccgagacgtggcaatattgtagaaaccaatcgtgg
ggcgaggatgatcagattttggtcgagaatttgcaaccttatacaaagtacagatttcgc
gtagcgttacttttaaaatcgtcccagcacaatcccgagcctatcgtctccgctccaagc
gtcgtgatacgaacgctggcggccggtttaccaacctcagcaccggtaattgtaagagcg
gtggcagtagacagttgccgcgcgtctgtgtcttgggaaccgggcccatttccaaacggg
ccacttttgtcttatgtcctgcgtctgcaaggggctgatcactcccagcttaaggatata
ccagcatcggagaacacggatcactacatgttccaaaatcttgaaccgaacaagaattat
tccattagcgtgaccatgagaaatggagttggtgagggaccacccgcggtgacttacatc
atgacaactccagaaccggctgtgaaagacacgcaacaacctattttaattcttggaggt
cagcacgtggttacgaagcagaacgcggatatgttggacgatcccagtgtggtttacgaa
aacacgagcacgattcgaggggtggcgattcacgtagcctccgcgcagcttttcatttcc
gattctttgggatacgtgtacagaacgtcgatcacgaaacgaacgatacccacggtgata
cttagccccagtcaagtgaacttcaagcctctcagtctgtccgttgattggttaaacctt
cacctgtacattttgggcgaggtgaaacacgcgaccacggtttggcagatagctaggtgc
aatttagacggaagaggtttgacggtagccgtggccggtttcttaacgcgacccacacac
atcgaggtagacccttacaacggttacttgttctgggtcacaagaggcggtttattccgt
ttagatctggctgacataagcaatggagtgaagcacgagattcagccatatttgattcta
gaagacgccgatttaggagcattcaccgtcgatcataccaactttcgtttattggttccc
catcatattcaaaacaccgtaatatccgtctccttggatggccgtgaagttttgaatctt
cgcgccaatacgcagcaaccgaaattcaagaacgtggtctccctggctatggcgaacggt
ttgttttattggacgaacggggaggaggtattgatagaaggataccatccgggacaaaac
agatattttcacaatgcttatccagataggtcgaacggttcatttgtcagtgtcaatgta
cttatgaacgcgagccagcccgttcctgtccccgtaaatcctcctacaggcgtgcaagct
gtgctgggcgtggagagggcgaaagtttcgtggcaagcgcctcatctattgggcggccag
gggaaaggcgcttggcagaattggtcttacgaattggagatcaaagacgagtctaccggg
gagacgatccatcagaaagatatcgccggctcgtctcatactgtgcataatcttcgagag
aaatcagaatactcgattaaagcggcggcatacacgagcgccggcagaggaccgtggtcc
accgagttcaggggtcgaacattgagagacggatcgcacgcgtccatattatggtcagcg
aacgaaggtctcttaaggagcgacgtgaccggagaaaatatcgatactttgatatacaaa
gcgagtttgaaagaaacggaggttgattatcatattgttgacgtcagttggtacaaggat
gtactctacatcgtaggaaacaattctgcgttgtatcgttacaacatcacgagtcatcaa
aagatgaagatgaatattcattctgtcggaagcgttgccgtcgattggatatcgaaaaaa
ttgtattgggctaatccaaagcaacaaattataacaagggctaatttaaatggatctcat
caagaacccatgtcgatcctggccatcgttaaagaattgatgatcgattctttggaagca
tatctatattggtcgacaggccatgctgttgaagtagctcgtctaaacggacaggacaga
agatattatcactcggatgaaatatttaatgggaaacaagtgatggggttaacactggac
acagaaaacagattcgtttactggattgttcggagttacgaaagtggatctattgtttat
cgagcaccaacgtccgagaggatttctatgagccacaaaatcgtgcctgaaaagatctct
gctctgcaacatccaaacatgcaaggtcctttatgctacttctcagaacatcttctctgg
cttcaagacgatcggaatgcggtgataggcgatctgtctggccaaaacacggctataata
aatggtatcactttgtcgggcctccatatgatagctatcatggatccggcactccatcaa
tatccgaagaactttacatccgagaccgtaacggtattacccaacgccgtcaattatgac
agtattagggtggaaggaacatggagaaacttcaacatatcctgggacccggtggagaat
atcaattacgggactgtgttttatgaagtgaaatttgcggattatatcaacactaattcg
aatccagagataaccacggaaacatctatgccttacaataattcagaacagattttgcct
tattcggttctcgaagtcactgtaaaagcgtttacgtattgggaaacggctcatcatacg
aggaagatattgagatcaccgcagagtgttccgagtcagccaactaattccagagcattt
atagaattccataaggaaccgttgagcgataacattgatatatttgcgatatttagatgg
gatcaacccgagttcacgaatggtctgatcacagggtatacggtacaatgttggttcaag
gagcacaacgtcgagatacaaatctgcgatcaatcgcttatcccgtccacattgttagag
tacacagttcaagatctcttgccaaacatgacatattactttcaagttcgtgctcatacg
aaaattggcgcgggattgtacacagacgtgatcaacatttccacgatatacgaaaatccg
gtgccacaattgttggtagctacaatggacgcggtcagaatatccgatttagatcaggaa
gtgaactatacaattacgcgacatatcgcggtcgaggttacttatctggctacagagagc
aagatttattggatcaacgaaatgagagaattggtaacatcggatttgaatggatcaaat
gctactaaaatgttggcattaaacaacagtgcacttagcataactgtcgattgggttgcg
aggcatctttactggtccgagttgagttatagagaaaatggcgggcgcatcatgaaatta
gacttgaccttgtggcaagttggaattctcaagtacgaaagtatcgtcacgtcgaacaga
cgtatcgtaaatcttgacatattaccatccacaggatcgttgtattggatagagactaaa
aaggatggcgggataataatgcaatctaatttagacgggacagacattcaaccgttcttc
aattacatagatgattgttcctgcccttacagaccgtccgtcagcccggtgatgaccatc
gacagtaccaattttcaaaaaccggtcatgtattggatttcgttggaaggtcacttaaat
atcgccgatatcgatgggtgtgcatgcaatttgatagcaagcgcgagcttcaataaagga
ttaccgccaaaatcgttaacggtcgataagatgaatatttattggtccaacatcgcggag
gatcagatttactttgtaaataaaaaatatcccgatgacgcggagatcagacacttctat
ttgccatccgtacgaagcatcaaagcccttggaaaatccttgcaaacttatccgatcacg
aactgtttgatccctcgtcaagggatcctatcctacaatgtggaagaaatgaagaaatcg
gcaaacagtattacagtcagacttcccgagcctgttccacaattcggttgcgaaagatac
agtttgcccaccacgttgtacacgatatacgtatctcagtgtttggaaaatgatcctaat
atgtgcgagaatggcgacaggataaagttacaaacttacaagaaagaatacgaaataaag
gatttgaagcctttcaccaactatggattgaaactggctttgagtaattattatgccaat
ttggaatcgatgagcttggaatttggttccggtgttgtgttacaaaccgaagcaggagca
cctacggccccggaaaacgtaaccgtcgaagcactcacgccaactttggccattgtatat
tggatgccgccaaaaatattaaacgccccagcagtgagatacgaagtgcattggagactg
gttcgattaataaacggggcacgacagaagggagagtttataaagggtacggagcgtacc
acggacggcagatacttcaccatgttagaaccgtggttacccgatcaagaatatctggtg
ttcgtccgtgcttatcccactcacgtcaacgatgtttacagcgaaagctcaagtcaagta
gttaaaatgtatccggaacccaataatttaactttaactggggttagcgtaaatagcttg
aacgtatcttgggtaccaacgatcaacttgatggtcagatatacgttagagtacaaagac
gttgccatggaagattggcaagtggccaacgatttcaaggtagacaaggacaaggtgacg
tattttatcaagaaactgcaacctcgaactttgtacaaattccacttgcttctgagatat
cctaattacaagaaggatttcgtctggccaactgatggaagattcacttttcaaacttta
ggtgatgtaccgagtgctcctggtatgcctacggtaaccaaacttcgtaattcagtctac
caattgaattggaaaccggcacaagctcatggttcgcaaatcacgttataccgtgtcgaa
gggatgaaaatcaatgagattaacgagcaaatagactcgactgggaacgcaagttggaag
ttgtattacaatggtacagacaattactggataatcacaggagacatggatgacaaatac
aggtttcgagttcaagctaggaacgcgtacggtttcggtggttggagcagatccagcccg
atcattgatttaacggaagctaccggtgggatattagcggctcaacaacatcttggttta
gtgttgggacttagcgtccctgttatcattattatgctcatttgttcctgttatttcctt
tgcctgtaccgacaacgcaaagaagataaaaaggcggtcttacctccgttagtaagcgat
gtcgaattagcaacacttcgagagataccacgtggaaatttcgttcaatccaacgcttta
tacgcgtctacattgcaaaacgattcggacgactctacccttcctaaaattagaagggaa
caaataacattagcgaaatttttgggtagtggagcttttggagaagtatttcaaggaaat
gcgaaggatttggaaaggccaggaattacaccagtcgcaattaaaacgcttcgaaaagga
gcttcggctcaagagaagacagaattccttcaggaagctagactcatgagtcattttcga
cataaacatgtactcagacttttaggagtttgcttagatacggatccaccattgttagtg
ttggaactaatggaggctggggacttattgagttatttaagggcaagtcgatctctgcaa
ccatcggattcacacgcgttacgactgcaagatttacttgccatgtgtgaagatgtagca
agaggatgccgttatttagaagagcttcattttgtacatagagatcttgcgtgtagaaat
tgtttggtatcggccaaagatcgagagaatcgtgtcgttaagattggtgactttggactt
gctagagatatatacaaaaacgattattatcgaaaagaaggagaaggattacttcctgtt
cgatggatggcacctgaatctttagtagatggtgtattcacctcgcagagtgatgtctgg
gcatttggtgtattaatgtgggaaattacttcgttgggccaacaaccgtatcctgccaga
acaaatatcgaagtattgcatcatgtacgtgcaggtggaagattgtccaaacctttgaat
tgtccactcgcgttacatcaactcatgttgcgttgttggagcgatgttgataccagacca
agttttaaagtttgtctagaaaatatagttagtcttcgaagtactatagaggatgcacaa
ttaaatccagttgctagttattacttatctagaaggggcgtctctaacatggcttacttt
gctgacgagaaccaaaatcataacaattcagggaattcatggaaatcgagcagttcagaa
ggtagtcgagatatgcaaccattccttcagaattcccataatgcaacacctacatcacaa
tcgggggaaatgccaaaatatttagaattattagcagataatgaagatattattctaaaa
gaaaattcaacaaatggatacgaagtgccacggtcaattcacatatctgatcaaaattta
gctaatacaaataaagctagtacaaacgtagatgtaaaaagtaatttgcattctgatgca
tcgcaagaacaaaaagatattatttcgagtgatattaaagaacaattggaaaaaaaatgt
gataaaagatcatcgatatctagtttaaatttaccggaacgtaaaagggcatcgattaca
aatatgactgagaaatgtaatactttagatagttcgaaattaactaatcctactattaaa
gcgatattaaaaagagattcatttacgtcattgactgatcaacggaaaaataaaagaaac
gtaactgaacgacgaggatctgaaataagtttagaaggtagaagttctagttctttaagc
tcgaatattagtttagcaccacctactcgacctagttcatcgttaattagttcacaaaat
gttcttccattaaagaattgtgttattggaggaactggcgaatcaactgataacgtcgcg
aagaatacattaccgaaaattcaaagaactcattctaatttacaaaatggtaaagctaat
atacctttagtgataaacagtgcattattaaatttgttaagacagactccagttgttgaa
gatagtaacaatatagttacatatacgaacattaatacagatgctgtaagagtaaatgga
tcgtga

DBGET integrated database retrieval system