KEGG   Apis mellifera (honey bee): 410719
Entry
410719            CDS       T01057                                 

Name
(RefSeq) syntaxin-17
  KO
K08491  syntaxin 17
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04130  SNARE interactions in vesicular transport
ame04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    410719
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    410719
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ame04131]
    410719
Membrane trafficking [BR:ame04131]
 SNARE
  Syntaxin (Qa)
   Stx-sER
    410719
SSDB
Motif
Pfam: MRP-S23 Rx_N
Other DBs
NCBI-GeneID: 410719
NCBI-ProteinID: XP_016769070
BEEBASE: GB46404
AA seq 300 aa
MSSSPENIAIKQPIRRLEIQINNFNVAIPHHVDLLKRHKTNIQKYQAQHDWEKMRREHIN
VARIIKQLKELLYQMDTLRAHVLDSDINQFDKLTANARASILNAIKEYMELELNLPMSPE
SSINEDQANSHPLDNTYIQLQKEQQDLQHQEACLHAWNTLQGDIHQLHQLFVDFNKIVDD
QKELVNSAEDDIVEANINVKEGEKFLEKAARYKVAMYPLAGAVIGSCIGGPIGLLAGLKV
GGLTAIGCGILGFTGASILKKKEIEMQKSKSVVEHELTEQKPIQRSSSLPENLKETKKEL
NT seq 903 nt   +upstreamnt  +downstreamnt
atgtcgtcctcaccagaaaatattgctataaagcagcctattagacgcttagaaatccaa
attaataatttcaatgtggcaataccacatcatgttgatttgttaaaacgacataaaact
aacattcaaaaatatcaagcacaacatgattgggaaaaaatgcgtagagaacacataaat
gtagcaagaattataaaacaactcaaagaacttttatatcaaatggatactttaagagct
catgttcttgattctgatattaatcaatttgataaactaactgctaatgcacgtgcgagt
attctgaatgcaataaaagaatatatggaattagagttaaatttgcccatgtcgccagaa
tcatccataaatgaagatcaagctaatagtcatccacttgacaatacatatatccaactt
caaaaagaacaacaggacttgcaacatcaggaggcatgtctgcatgcttggaataccttg
caaggagatatacatcaattacatcaattatttgttgattttaacaaaattgttgatgat
caaaaagaattagtgaattcagcagaagatgatatagtggaagcaaatataaatgtcaaa
gaaggagaaaaatttcttgaaaaagctgctagatataaagttgctatgtatccattagca
ggagctgtaataggatcttgtattggtgggccaattggtttattagctggattaaaagtt
ggtggactaactgccataggttgtggtattttaggatttactggagcatctatattaaaa
aaaaaagaaatagaaatgcagaaatcaaaatctgttgtagaacatgaattgactgaacaa
aaacctatacaaagatcatcatctcttcctgaaaatttaaaggaaactaagaaagaatta
tga

DBGET integrated database retrieval system