KEGG   Apis mellifera (honey bee): 410724
Entry
410724            CDS       T01057                                 
Name
(RefSeq) protein prickle isoform X2
  KO
K04511  prickle
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    410724
SSDB
Motif
Pfam: PET LIM Sgf11
Other DBs
NCBI-GeneID: 410724
NCBI-ProteinID: XP_006569668
BEEBASE: GB44796
UniProt: A0A7M7H312
Position
LG1:complement(11205469..11294717)
AA seq 857 aa
MPPSSILSTRYTARWYPVIYRGLTTQCHDITLLLAWCGASASAGAAVKWFHFNNESIYAG
YYATRERIRIRLCIKSRILVSNDSRVTLSKTNWMLSPQDGQSNTYSHGNVVLQGAPCGQC
RDLCPAGYVPHFWRKVCRSCRCPREEHQRTSTEAGGPSGLGLGPGPPMAMAMAFQSGAAG
SSHQEPFKSPVQPAPPGLALQEALMHHQRHSQSDDDSGCALEEYTWVPPGLRPDQVHLYF
SALPEDKIPYAGSAGERERVKQLLQQLPPHDNEARYCSGLTEEEKRELRVFAAQRKREAL
GRGHASQLDRAHGAGCRECSRPIAAGEMAVAASRAGPSALWHPACFVCCVCRQLLVDLIY
FWKEGRLYCGRHHAETLKPRCCACDEIILADECTEAEGRAWHMRHFACLECDRQLGGQRY
VMREGRPYCLRCFDASFAEYCDSCGEPIGVDQGQMSHEGQHWHATEACFCCATCRASLLG
RPFLPRRGAIYCSIACSKGELPTTPSDSSAGPPPPPPSFLRTGRRPPPPSEGSSSPPPPP
PPPPPPGSRHTLCSPRNSPRMNRKHHQTSASLATTPTQSTLSPEFPVEAFPSSSSRSNGL
DRVLLERNLERLLQERSSHPEESRNELGRLMQARDREPLRCIQNCAPSHASSMPELPPPP
RPSSGASASASTSTSTGVVATTISGVVLESATSPTTLIVGGQTDPPTPTSRRVRFQGDLD
MNDHAASSSRIPLSPDNDRNSSSSPSPPLTSLSRTNVSRSRSLQSEEVADTSVWGIAGNS
KSRIDGDEEDIESCCSTCSSSSSSDEAAAYALPPRRAYGGVRISYVPNDAVACARKRTPT
SSTSNQTQRDTDKCIVS
NT seq 2574 nt   +upstreamnt  +downstreamnt
atgccaccgtcgtcgattctctcaacacgatatacggcgcggtggtatcccgtgatttac
cggggcctcacgactcaatgccacgatattacactattactcgcgtggtgtggtgcaagt
gcaagtgcaggtgcagctgtgaagtggttccacttcaataacgagagcatatacgcggga
tattacgcgacacgagaaaggattcgtattcggctatgcatcaagtcaagaatcctcgta
tctaatgattcgcgagtgacgctttcgaaaacaaattggatgttgtcacctcaagatggt
caatccaacacttactcgcacggtaatgtcgtccttcaaggtgcaccctgtggtcaatgt
cgagatttatgtccagctggatacgtgcctcatttttggcgaaaggtgtgcagaagctgc
aggtgtcccagggaggaacatcagcggacttcgacggaggcgggtggtccctcgggactc
ggcctcggtcctggtccgccgatggccatggccatggctttccaaagtggggccgccggt
tcttctcatcaggaacccttcaaaagtcccgtgcaaccggctccgccgggcctcgccctt
caggaggccctgatgcatcatcagaggcattctcagagcgacgatgacagcggatgcgcc
ctcgaagagtacacgtgggtcccgccaggtctcaggccggatcaagtacacctgtacttc
agcgcactaccggaagacaagatcccgtacgcgggcagcgccggcgagcgggaacgggtg
aagcaactgctgcaacaactcccaccgcacgacaacgaggcacggtactgcagcgggctg
accgaggaggagaagagggagcttagggtgttcgccgcgcagcggaaacgcgaagcgctt
ggacgaggacacgcgagccagctggacagggcccacggcgccggatgccgcgaatgcagc
aggccgattgcggccggtgagatggcagtggctgcgagccgcgccggtccatccgccctc
tggcatccggcctgcttcgtctgttgcgtgtgcaggcagctgctcgtcgacctgatatac
ttctggaaggaaggcaggctttactgcggcaggcatcacgcggaaacgttgaagccgaga
tgctgcgcttgtgacgagatcatacttgccgacgaatgcacagaggcggaagggagggcg
tggcatatgaggcacttcgcctgcctcgagtgcgatcggcagcttgggggtcaaaggtac
gtgatgagagaaggcagaccttactgtctccgatgttttgatgcctcgttcgctgagtat
tgcgacagttgtggcgaaccaattggtgtcgatcaagggcaaatgtcgcacgagggtcaa
cattggcacgcaaccgaggcttgcttctgttgcgccacttgtcgcgcatcccttcttgga
cgaccatttcttccacggagaggtgccatttattgcagtattgcctgtagcaagggggaa
ctaccaacgacgccaagtgactcttctgctggaccaccaccaccaccaccttccttcctt
agaactggccggagaccaccacctccaagcgaaggttcctcaagtccaccacccccacca
ccacctccaccaccacctggatccagacatactctctgttcgccacgtaattcacctcgg
atgaatagaaagcatcatcagacatctgcttctctagcgacaacacctacgcaaagcact
ttaagccctgaatttccggttgaagcatttccttcgagcagttccagatcaaatggtctt
gatcgtgtattactcgagaggaatcttgaaagacttcttcaggaacgtagttctcatcca
gaagaaagtcgtaacgaattgggaaggttgatgcaagcgagggatcgtgagccattaaga
tgcattcagaattgcgctccttcccacgcgtcaagcatgccagagctaccaccacctccc
cgaccatcatctggagcatcggcatcggcatcaacgtctacatcgaccggtgttgtcgcg
acaacgatatccggggttgtgctagaatcggcgacatcgcctaccaccctcattgtcggg
ggtcaaaccgaccctccgacaccaacgtcgcggcgcgtgcggtttcagggcgatttagac
atgaacgatcacgcagcgagctcctcccgtatccccctgtcgcctgataatgataggaat
tcgtcatcttcgccttctcctccgcttacatcgctctcgagaacaaacgtgtctcgatcg
agaagcctacaatcggaggaagtagctgacacatccgtttggggtattgctggaaactca
aaatcgaggatagacggcgatgaagaagacattgaatcatgctgttccacttgtagctcg
tcaagcagttccgacgaagctgcagcttatgctttacctccaagaagagcatatggcggt
gttagaatctcttatgtgcccaatgatgcagtggcatgtgcaaggaaacgtacaccgaca
tcctcgacgtcgaatcaaacgcagagagatacagataaatgcatcgtgtcctga

DBGET integrated database retrieval system