KEGG   Apis mellifera (honey bee): 410823
Entry
410823            CDS       T01057                                 
Name
(RefSeq) transient receptor potential-gamma protein isoform X1
  KO
K04967  transient receptor potential cation channel subfamily C member 4
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:ame00001]
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    410823
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ame04040]
    410823
Ion channels [BR:ame04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   410823
SSDB
Motif
Pfam: Ion_trans TRP_2 Ank_2 PKD_channel Ank_3 Ank_4 Ank_5 Ank Holin_BhlA
Other DBs
NCBI-GeneID: 410823
NCBI-ProteinID: XP_006569011
BEEBASE: GB55618
UniProt: A0A8B6ZA58 A0A7M7GY42
Position
LG2:complement(13897382..13976504)
AA seq 1191 aa
MDTNTSRGWNSGGRAFLRGIGQRVSFDPEAPPPPSQPARKIDEKVKRHSIHGMIEEENVV
RPHQEMASLSYQEKKYLLAVERGDVASVRRMLQSAQETEMNINCVDPLGRSALLMAIDNE
NLEMVELLIEHKVDTKDALLHAISEEFVEAVEVLLEHEESLHRNGEPHVSRFHRLVYSWE
ALPSDTATFTPDITPLILAAHRDNYEIIKILLDRGSTLPMPHDVRCGCDECVTSRREDSL
RHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKCEYQELRRQCQD
FATALLDHTRSSYELEVLLNHDPTGPAFEHGERMHLNRLKLAIKLRQKKFVAHPNVQQLL
ASIWYEGLPGFRRKNMVLQALEIVKIGVLFPFFSVAYIIAPHCVVGQTMRKPFIKFICHS
ASYFTFLFMLILASQRIESVIGNWMGRDVVEQDTVPTKRGAAPTIIEWFILAWVSGLIWS
EVKQLWDVGLEEYVNDMWNVIDFVTNSLYVATAALRVVAYYRVKWEIEKSGSEVELQREQ
WDTWDPMLISEGLFSAANIFSSLKLVYIFSVNPHLGPLQVSLSRMVMDIMKFFFLYVLVL
FAFSCGLNQLLWYYADMEKKRCPTAMSYAPNASVTTDSNACIVWRRFANLFETTQTLFWA
VFGLVDLESFELDGIKAFTRFWGMLMFGTYSVINIVVLLNLLIAMMNHSYQLISERADIE
WKFARSKLWISYFEEGGTVPPPFNIIPTPKSVWYMGQWLYRKLCGHSRAAKKEHMRTIRR
KVKQASERDFRYQSIMRNLVRRYVTVEQRKAESEGVTEDDVNEIKQDISALRCELIEILK
NSGMNTSTASGTGTDGSLKELSIGAGGKKNRQKERRLMKGFNIAPQPSGSGSLPPVDEFA
ASLQQAQQENSHELFGSTLSGIFGPGTTPKKSPHHTSTNSVPGLGTSRQSRRIRGSSKKK
RWENLIEAAKVRGKVSRLIGRSRSEDSVYSPASEDGGSRSEGSTDSKSSLEQGANDGQPT
HHPHHAHHSHHHEGGHHVFPHGLGALVALRKKRKTFSDSRSSTSGMRSGSGTNPIYPLAT
ALVSKVSRKQQLQRASSVPTRGPELGQQPIPPRRHEGTQSQQPSIDTPEGASANEQPVVP
AAPLTPSTTEESVAASTSLPATMKRNGSATQLQRLPGIEPISGHDVSGGWL
NT seq 3576 nt   +upstreamnt  +downstreamnt
atggataccaacacgagcaggggctggaactcgggcgggagggcattcctgcggggtatc
gggcaacgcgtcagcttcgaccccgaggcgcccccgccgccgtcccagcctgccagaaag
atcgacgaaaaggtgaagaggcacagcatccacggcatgatagaggaagagaacgtggtg
agacctcaccaagaaatggccagtctgtcctatcaagagaagaagtatcttctcgcggtg
gagcggggagacgttgcctccgtcagaagaatgttgcaaagcgcccaggaaaccgaaatg
aacatcaattgcgtggatccgttgggacggtccgccctattgatggcgatcgataacgaa
aatctggagatggtggagcttctgatcgagcacaaggtcgacacgaaggatgcccttctc
cacgcgatctccgaggaattcgtggaggcggtcgaggtgcttctggaacacgaggagagt
cttcatcgaaatggggagccacacgttagtcgctttcatcgtctagtatatagttgggaa
gccctgccatccgacacagccacgttcacaccagacatcactcccctgatcctagccgcg
cacagagacaattacgagatcattaagattcttctggatcgcggatccacgttgcctatg
ccgcacgatgttcgttgcgggtgcgacgagtgcgtgacatcgaggagggaggattccctg
aggcattccaggagtcgaataaacgcgtacagagccttagcctcgccgtccttgatcgcc
ctttcctcaaaggatccaatcctgacggcgttcgaactctcgtgggagctccgccgcctc
tcgttcctcgagcacgagttcaaatgcgaataccaggagctcagaagacaatgccaggac
ttcgccaccgccctgttggatcacacgagaagttcgtacgaattggaggtgctgttgaac
cacgatccgaccgggcctgcgttcgagcacggcgagaggatgcatctgaaccggctcaag
ctcgccatcaaacttcgacagaagaagttcgtggcgcatcctaacgtgcagcagttactc
gcatcgatttggtacgagggtcttccgggcttccggaggaaaaacatggttctccaggcg
ttggagatagtcaagatcggcgttctattccctttcttcagcgtcgcgtacatcatcgcc
ccccactgcgtggtcggccagaccatgaggaaaccgttcatcaagttcatctgtcactcg
gcctcctacttcaccttcctcttcatgttgattctggctagtcagaggatagagagcgtg
attggaaattggatgggcagggacgtggtggagcaggatacagtgccgacgaaaagggga
gctgcgcctaccatcatcgaatggttcatcctggcgtgggtctcgggcctgatttggtcc
gaggtgaagcagctgtgggacgtcggcctcgaggagtacgtgaacgacatgtggaacgtg
atcgacttcgtgaccaactccttgtacgtggccaccgccgccctaagggtggtcgcctac
tacagggtcaagtgggagatcgagaaatcgggatcggaggtcgagctccaacgcgaacag
tgggacacgtgggacccgatgctcatatcggagggtcttttctccgccgccaacatattc
agctccctgaaactcgtctacattttctcggtaaaccctcacctcggccccctgcaagtc
tccctgtccagaatggtgatggacatcatgaagttcttcttcctctacgtgctggtgctg
ttcgcgttctcgtgcggtttgaaccagttgttgtggtattacgcggatatggagaagaag
agatgcccgaccgcgatgtcgtacgcccctaacgccagcgtcaccaccgattcgaacgct
tgcatcgtttggcgtcgatttgcaaacttgttcgaaacgacccaaacactgttctgggcc
gtgttcggcctggtcgatctcgagagcttcgaattggacggtatcaaagcgttcaccagg
ttctggggtatgctgatgttcggcacgtactcggtgatcaacatcgtcgttttactcaat
ctattgatcgccatgatgaatcattcctaccaattgatctccgaacgcgccgacatcgag
tggaagttcgccaggagcaagctttggatcagctacttcgaggagggtggcacggtccca
cccccgttcaacatcatccccaccccgaagagcgtctggtacatgggccaatggctgtac
aggaaactgtgcgggcacagcagagcggccaagaaggagcacatgaggacgatcagaagg
aaggttaagcaggcgtccgagagggacttcagatatcaaagcatcatgagaaatttggtg
aggaggtacgtgacggttgagcagaggaaggcggagagcgagggggtgaccgaggacgac
gtgaacgagatcaagcaggacatcagcgcccttcgttgcgaattgatcgagatcctgaag
aattccgggatgaacacctcgacggcaagcggtaccggaaccgacggtagccttaaagag
ctgtccataggtgcggggggtaagaagaatcgtcagaaggagcggcggctgatgaaaggt
ttcaacatcgcccctcaaccgagcgggagcggctcccttccccccgtagacgagttcgcg
gcttcgttgcaacaggcgcaacaggagaactcgcacgagctgttcggctcgacgttgagc
ggtatattcggtccgggcacgacgcccaagaagagccctcaccacacgagcacgaacagc
gtgccaggcctcggtaccagcaggcagagccgtaggataagagggagctcgaagaagaag
agatgggagaatctgatcgaggcggccaaggttcgcggcaaggtttccaggctgatcggc
agatctcgttccgaggattccgtgtactcgcccgcgtccgaggacgggggttccagatcc
gagggatcgaccgactcgaagtcgtcgctggagcaaggcgcgaacgacggccaaccgacg
caccatccccatcacgcacaccactcgcatcaccacgagggggggcatcacgtgttccct
cacggcctaggcgcgttggtggcgcttcgaaagaagcggaagacgttctcggattcgagg
tcctcgacctcgggcatgaggagcggaagcggcaccaatcccatatacccgttggccact
gccctcgtctccaaggtgtcgaggaagcagcaactgcagagggcgagcagcgtgccgacc
agggggccggaactgggccagcagccgatcccgccgaggcgacacgagggcacgcagagc
cagcagccgagcatcgacactcccgagggagcgagcgctaacgagcaacccgtagttccg
gcggcaccgctgacaccatcgaccaccgaggagagcgtggccgcgagcacctccctccct
gcgaccatgaagaggaacgggtccgcgactcagctgcaacggcttccgggcatcgagccg
atatccggccacgacgtgtccgggggatggctctga

DBGET integrated database retrieval system