KEGG   Apis mellifera (honey bee): 410833
Entry
410833            CDS       T01057                                 

Definition
(RefSeq) adenosine deaminase-like protein
Organism
ame  Apis mellifera (honey bee)
SSDB
Motif
Pfam: A_deaminase Amidohydro_1
Other DBs
NCBI-GeneID: 410833
NCBI-ProteinID: XP_016766278
BEEBASE: GB55421
UniProt: A0A088AUM3
AA seq 345 aa
MNLEKFCHDLPKLELHAHLNGSLSADTLKELYKMQNSELGNYEDVFMDMKDFSTLNECFK
VFDIIHLLTVTPEAIFHATYNTIKEFQDDNVIYLELRSTPRAIPEKMSKQEYVEAIIKAF
EVCKIDFPNILVKLLISVNRKQGYKAAQENIELAINFMKKYPQYIVGLDLSGDPMTGSIF
LKLLKKARMAGLKIAAHCAEVSNETEAIDILEFKPDRLGHCTCVHPTLQGTNKLFNLLIN
SKIPVELCLTSNVRCKTVPTYESHQFKYLFEVGHPICLSTDDKGVFHTSLSQEYKIASST
FNLSREQLIKLCLSSVQYAFVTSEEKEVLLSKIKNFYCKEYTIKD
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgaatttagaaaaattctgccatgatttaccaaaattggaacttcatgctcatttgaat
ggatctttaagcgcggatactttaaaagaattatacaaaatgcaaaattctgaattagga
aattatgaagatgtatttatggacatgaaagatttttcaacattaaacgaatgcttcaaa
gtatttgatataatacatttattgacagtaacaccagaggcaatttttcatgctacttat
aatacaattaaagaattccaagatgataatgtaatatatttggaacttagaagcacacct
cgtgctattcctgagaaaatgtcaaaacaagaatatgtagaagcaatcataaaagcattt
gaagtctgcaaaattgattttccaaatatattagtgaagttattaatatctgttaatcgt
aagcaaggatataaagcagcacaagaaaacatagaattagcaataaattttatgaagaaa
tatccacaatatattgttggacttgatcttagtggagatccaatgacaggaagtattttt
ttaaagttattaaaaaaagctagaatggctggacttaaaatagcagctcattgtgcagag
gtttcaaatgaaacagaagcaatagatattcttgaatttaaaccagatagattaggacat
tgtacttgtgttcatcctacattacaaggaacgaataaattatttaatctgcttattaat
tcaaaaattcctgtagaattgtgtttaacttcaaatgttcgatgtaaaactgtacctact
tatgaatctcatcaatttaaatatttgtttgaagttggtcatcctatttgtcttagcacc
gatgacaaaggtgtctttcatacatctttatctcaagaatataaaatagctagttcaaca
tttaatttaagtcgagaacaactaataaaactttgtttatcatccgtacaatatgctttt
gttacatcagaagaaaaagaagtattattatctaagatcaaaaatttttattgtaaagaa
tatactattaaagattga

DBGET integrated database retrieval system