KEGG   Apis mellifera (honey bee): 411288
Entry
411288            CDS       T01057                                 
Name
(RefSeq) cAMP-specific 3',5'-cyclic phosphodiesterase isoform X2
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00230  Purine metabolism
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    411288
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     411288
SSDB
Motif
Pfam: PDEase_I PDE4_UCR
Other DBs
NCBI-GeneID: 411288
NCBI-ProteinID: XP_006568587
BEEBASE: GB42000
UniProt: A0A8B6Z9E4 A0A7M7H1N8
Position
LG8:complement(10955749..11211303)
AA seq 1010 aa
MDDDDTEEKRESVTLVNKLSRKETKTKLLVSSSKLVSMSSKLESRQRNSTESSDTMECAS
ENEVENIPKDEETSEPLVTDEKGNKICGGDRRSLDVAEEGETLVTASSRQHTVTKTSLKV
CEEDGRPVRFPGIRLGFFHPRSPQSSSSQEDYEPEVKSLSKLEKQQPQQQQHLLTARGSQ
STSSQITAKSMESLRTSRNFLSADERYVDDSKSLESLSESHVAASKSHYRSFLTSSTRDV
RRIVTVESKSSDNLHREESLNAEVRRGLFANTGLERKIPQNLSLPPPSNVFSLTSPGGSD
RKITILSPHSPLQTTEFQFSQTLKTRRKKAIVLPRLVLPRSESDVFFSDFDVENGASTLD
GGAGGGGGASPSAGLVLQTLPQRRESFLYRSDSDFEMSPKSMSRNSSIASERFKETELPV
ERAHGEDLIVTPFAQILASLRSVRNNFLSLTNVPTNKSRRSSGAQGSSTPQPRILAPGEE
NYMKLAVETMEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSKSGNQISE
YICSTFLDKQQELDLPSLRIEDAVAAAGSTDARAAKKKDRAQRGPAAMSHISGVKRPLTH
TNSFTGERVPLHGVETPHEEELGKLLSDIDKWGIDIFRIGELSNNRPLTCVAYTAFQTRD
LLKSLAIPPKTFVTFMMTLEDHYVKDNPFHNSLHAADVTQSTHTLLNTPALESVFTPLEI
TAALFAATIHDVDHPGLTNQFLINSSSELALMYNDESVLENHHLAVAFKLLQNEGCDIFV
NMTKKQRQTLRKMVIDMVLSTDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQVL
ENLVHCADLSNPTKPLPLYRRWVGLLMEEFFLQGDREREQNMDISPMCDRHSATIEKSQV
GFIDYIVHPLWETWADLVHPDAQDILDTLEENRDWYQSMIPPSPPSDDQQQQQQGNEQQS
DRIHFQVTLEEGDETGETTEIGDTGGAAKTILASEEGGGETDENAAEAGM
NT seq 3033 nt   +upstreamnt  +downstreamnt
atggacgacgacgacacggaagagaagcgggaatccgtgaccctggtgaacaagctctct
cgcaaagagacgaaaactaaattgctagtttcatcctcgaaactcgtgtccatgagctcg
aaactcgagtcaaggcaacgaaattccacggaaagctcggacaccatggagtgcgcgtcc
gagaacgaagtggagaacataccaaaggacgaggaaacgtccgagccgttggtcacagac
gagaaagggaacaaaatctgtggcggggatcgtcgttccttggacgttgctgaagaaggt
gagacgctggtcaccgcaagcagccgccaacacaccgtgacgaagactagcctgaaagtg
tgcgaggaggatggcaggccggtcaggtttcctggaatcaggctaggtttcttccatcct
cgaagccctcaatcctcgtccagtcaggaggattacgagcccgaggtgaagagcctgtcg
aaacttgagaagcaacagcctcaacagcaacagcatctgttgaccgcgagaggtagccag
agcaccagcagccagataacggcgaaatcgatggaaagtctgagaacgtcgaggaatttt
ctgagcgcggacgaacgctacgtggacgactctaaatcattggaatcgttgtcagagtct
cacgtggccgcctcgaaatctcactacagaagcttcttgacctcgtccaccagagacgtg
aggaggatagtgaccgttgagtcgaaaagcagcgacaatcttcacagggaggagagcctg
aacgccgaagttagacggggccttttcgctaacacggggctagagaggaagatacctcag
aatctgagccttccaccgccctcaaacgtgttttcgttgaccagcccaggcggcagtgac
agaaagatcactatactcagtcctcactcgccgctccagaccaccgagttccagttctca
cagacgttaaagaccaggcgtaagaaggccatcgtcttgccgaggttggtgttgcccaga
agcgaatccgacgtgttcttctccgatttcgacgtggaaaatggcgcctcaacgttggac
gggggtgccggaggcggtggaggcgcctcgccaagtgcaggcttggtgttgcaaaccctg
ccacagaggcgagagagcttcctgtatcgcagtgatagcgacttcgagatgtcgccgaaa
tcgatgtctcgaaacagttcgatcgccagcgagaggttcaaagagacagagcttcctgtc
gagcgagcccatggcgaggacctcatcgtcacgccgttcgcgcagatccttgcctctctg
cgctcggtcaggaacaacttcctgtcgcttactaatgtgcccaccaacaaatcacgaagg
agtagcggtgcacagggtagcagcacgccgcagccacggatcttggcaccgggggaggaa
aactacatgaaattggcggtggagactatggaggagctggactggtgcctggaccaactg
gaaaccattcagactcatcgatccgtgtccgacatggcctctctgaagttcaagcgtatg
ctgaacaaagagctgtcccatttctcagaatcctcgaaatccggcaaccagatatcggaa
tacatatgcagtaccttccttgacaagcaacaagagttggacctaccctcccttcggatc
gaggatgcggttgcagcagccggaagcacggatgctagggcggcgaagaagaaggaccgg
gcccaaaggggcccggccgcgatgtcccacataagcggtgtgaagcgacccctcacgcac
acaaacagcttcaccggggaacgtgtaccgcttcacggcgtcgagacaccccacgaggag
gagctcggcaagcttctctcagacatcgacaaatggggcatcgatatcttcaggataggc
gaattaagcaacaacagaccgctgacctgcgtcgcctacacagccttccagacccgggat
ttgctcaaatcgctggccataccgcccaagacctttgtgaccttcatgatgaccctcgag
gatcactacgtcaaagacaatcccttccacaatagcctgcatgccgccgatgtgacccaa
tctactcacactctgctcaacacacccgcactcgagtccgtgttcacgccgttggaaatc
acagccgctctgttcgcagccaccattcacgacgtggaccatcctggactcaccaaccag
ttccttataaattcgagctccgagctcgccctaatgtacaatgacgagtccgttctggag
aaccaccacctggcagtggcgttcaagttgcttcagaacgaaggctgcgacattttcgtc
aacatgacgaagaagcaacgccagacgcttaggaagatggtgatcgatatggtcctgtcc
acggacatgtccaagcacatgtccctgttggccgatctgaagactatggtcgaaacgaag
aaggtggccggttctggcgtgcttctcctagacaattacaccgaccgaatccaggtcctg
gagaacctggtgcactgtgccgacctgtccaaccccacgaaacctttgcccctctaccgg
cgatgggtcggcctgttgatggaggagttcttccttcaaggagaccgggaacgagagcag
aacatggacataagcccgatgtgcgacaggcacagcgccaccatcgagaagtcgcaggtc
ggcttcatagattacatcgtgcaccctctctgggagacctgggccgacctggtgcacccg
gatgctcaggatatcctggacacgttggaggagaatcgagactggtatcaatctatgatt
cctccgtcgccaccctccgatgatcaacagcaacagcagcaagggaacgagcagcaatcc
gatagaatacacttccaggtgacactggaagaaggcgacgagacaggcgaaacaacggag
atcggggacacgggtggagctgcgaaaacgatcctggcgagcgaggaagggggcggtgag
acggatgagaacgcggcagaggctgggatgtga

DBGET integrated database retrieval system