KEGG   Apis mellifera (honey bee): 411347
Entry
411347            CDS       T01057                                 
Name
(RefSeq) peripheral plasma membrane protein CASK isoform X3
  KO
K06103  calcium/calmodulin-dependent serine protein kinase [EC:2.7.11.1]
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ame01001]
    411347
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ame04131]
    411347
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ame03037]
    411347
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     411347
Protein kinases [BR:ame01001]
 Serine/threonine kinases: CAMK group
  CASK family
   411347
Membrane trafficking [BR:ame04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    411347
Cilium and associated proteins [BR:ame03037]
 Primary cilia and associated proteins
  USH complex and associated proteins
   411347
SSDB
Motif
Pfam: Pkinase Guanylate_kin PK_Tyr_Ser-Thr PDZ L27 SH3_1 PDZ_6 SH3_9 PDZ_2
Other DBs
NCBI-GeneID: 411347
NCBI-ProteinID: XP_006559979
BEEBASE: GB17597
UniProt: A0A8B6YTW7 A0A7M7LQH7
Position
LG9:3893499..4152305
AA seq 956 aa
MADDEVLFDEVYELCEIIGKGPFSVVRKCIHRQTGQTFAVKIVDVAKFTSSPGLSTNDLK
REATICHMLKHPHIVELLETYSSEGMLYMVFEYMDGSDLCFEVVRRATAGFVYSEAVASH
YMRQILEALRYCHENDIIHRDLKPQCALLAGKENSAPVKLRGFSVAVQLQTSQANGVGLT
SSPSCNFPFEDLTDAEDSLVSDTEDNIGRVGCPHFMAPEVIQRRQYGKPGDVWSAGVLLH
VLLTGTLPFVGSRDRLREAICRGRVQMETPLWDNISEPAKDLIQRMLTTDVNHRITIQEV
LNHKWLRDRDKGVARIHLAETIEELKKFNARRKLKDAVKVAISSSKWHIPYSEINGDSFF
DIGDDEVITTGAVAEIIDSLDDIEVLQESGRLTRAEILNAVDDYRLRAILELYDRISTRV
PTPCRAPQTDAVQRAREVEELLREIEHSAIRNIDRADLRELHELLVQPHMRALLQAHDVA
GHEVYGEEATRVTPPPLLPYLNGGDDLEGQNGDLDLENVTRVRLVQFQKNTDEPMGITLK
MNEDGKCVVARIMHGGMIHRQATLHVGDEIREINGIPVANQSVNALQKILREARGSVTFK
IVPSYRSAPPPCEVQLFRIKPLPVLIFVRAQFDYDPLEDELIPCAQAGIAFKTGDILQII
SKDDHYWWQAQKDNAAGSAGLIPSPELQERRIAYMAMEKNKQEQDAEGEGGCSSHTEGCD
GSTVNCSIFGRKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPYPAFQRKTLVLLGAHGV
GRRQIKNTIIAKHPDKYAYPIPHTTRPPRNDEENGRNYYFISHDEMMNDIHSNEYLEYGT
HENAMYGTKLETIRKIHEEGKVAILDVEPQALKVLRTAEFAPYVVFIAAPVFENITDCDG
SLARLAKESDSLKQAYGHFFDLTIVNNEIDETIAQLEAAIERVHTTPQWVPVSWVY
NT seq 2871 nt   +upstreamnt  +downstreamnt
atggcggacgacgaggttctcttcgacgaggtttacgagctctgcgagattatcggcaag
ggaccattcagcgttgtaaggaaatgcattcacaggcagacaggacagacgttcgcggta
aaaatcgtggacgtggcaaagttcacatccagccccggtctaagcacgaacgatttgaaa
cgagaggccacgatatgccacatgttaaaacatccccatatagtagagttgttagaaaca
tatagctcggagggtatgctctatatggtgttcgaatatatggatggctctgatttatgc
ttcgaggtcgtccggagagcaactgctggattcgtgtacagtgaagctgtggccagccat
tacatgcgacagatcctggaggcgttgcgctactgccacgagaacgacataattcatcgt
gatctaaagccccagtgcgccctcttagcgggcaaggaaaattccgcaccggtaaagcta
cgcggtttcagcgtcgccgtgcaactccagacgtcccaggcaaacggcgtcgggctgacg
tcttctccgagctgcaatttccctttcgaggacctgaccgacgccgaggattcgctagtg
agcgatacggaggacaatatcggtcgtgttgggtgtccgcacttcatggcgccggaagtg
atccaacggagacagtacgggaagcctggtgacgtctggtcagccggagtactacttcat
gtcctattaaccggtacacttccattcgtcggatctcgagatagactgcgagaagcaatt
tgcagaggacgagtacagatggagacaccattgtgggacaatattagtgaaccggccaag
gatctcatacaaagaatgctcacaaccgatgtaaatcataggattaccatacaagaagtg
ctgaatcacaaatggcttagagatcgtgataagggtgtggccagaatacatttagctgaa
actatagaagagcttaagaaattcaacgctagacgaaaattgaaagatgctgtgaaagtg
gcgatttcgtcctccaaatggcacatcccgtattcggaaattaacggtgacagctttttc
gatataggagatgatgaagttataaccacaggtgctgtagctgaaattatagactctctc
gatgatattgaagtacttcaagagagtggaagactgacgcgtgccgagatacttaatgca
gttgatgattatcgtcttcgagctattttagagctttacgataggatttcgactcgagtt
ccaacgccatgtcgagcgccacagacagacgctgttcagcgtgcgcgagaggtcgaagaa
cttcttcgagaaatagagcattcagcgatacgaaacatcgatagggcggatcttcgggaa
ctccatgaacttttggtccagccacacatgagggcgcttttgcaagcacatgacgtagcg
ggacatgaagtttatggcgaagaagccaccagagttacgccacctcctcttctcccctat
ctaaacggaggcgacgatctcgagggacagaacggtgatttggacctcgaaaatgtaacg
cgcgtcaggctggtccaattccaaaagaatacggatgagccaatgggaatcactttaaaa
atgaacgaagatggaaaatgtgtggtagcacgaattatgcacggtggtatgatacacaga
caagcgacccttcacgtgggtgacgagatcagagaaattaatgggataccggtggccaat
caatctgtcaatgccttgcaaaagatactccgggaagcacgaggttcggtgacgttcaaa
atcgtgccatcgtacaggagcgcgccacccccctgtgaggtacaattgttcaggattaag
cctctgccagtgttaatattcgttcgagcacaatttgactatgatccgttggaggacgag
ctgataccgtgcgcccaagccgggatcgcgttcaaaaccggcgacatcctgcagatcatc
agcaaggacgatcattattggtggcaagcgcagaaggacaacgcggccggttccgcgggg
ttgataccttctcctgaacttcaggaacgacgtatcgcttacatggcaatggaaaagaac
aagcaagaacaagatgctgaaggagaaggaggatgttcttctcacaccgaaggctgcgac
ggttcgacagtgaattgctcaatatttggccggaaaaagaaacagtacaaggataagtat
ctcgcaaaacacaacgcagtatttgaccagctggatctggtcacctacgaagaggtcgtt
aagcttccctatcctgcattccaacggaaaacattagtattactgggagcacatggcgtt
ggtcgtcgtcagataaaaaataccattatcgcgaagcatcctgataaatatgcctatcct
attccacatacaacgaggcctccacggaacgacgaagagaatggtcgcaattattacttc
atatcgcacgatgaaatgatgaacgatatccattccaatgaatacctcgaatatggtacg
cacgagaacgcaatgtacggaacgaagctcgagacgatccggaaaattcacgaagagggg
aaggtggcgatattggacgtcgagccccaagccttgaaagtgttgcgtacagcagagttc
gcgccttatgtagttttcatcgctgctccagtgttcgaaaatatcaccgattgcgacggg
agcctggcaagactggcgaaagagtctgactcgctgaagcaagcgtacggccactttttc
gacctgaccatcgtgaacaacgagatagacgagacgatcgcgcaattggaggcggccatc
gagcgtgtacacacgacaccccaatgggtaccggtttcctgggtctactga

DBGET integrated database retrieval system