KEGG   Apis mellifera (honey bee): 411472
Entry
411472            CDS       T01057                                 

Definition
(RefSeq) dynamin-1-like protein
  KO
K17065  dynamin 1-like protein [EC:3.6.5.5]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:ame00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    411472
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ame04131]
    411472
   03029 Mitochondrial biogenesis [BR:ame03029]
    411472
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ame04147]
    411472
Enzymes [BR:ame01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     411472
Membrane trafficking [BR:ame04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    411472
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    411472
   RhoA-dependent endocytosis
    411472
Mitochondrial biogenesis [BR:ame03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    411472
   Retention of mitochondria
    411472
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   411472
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_16
Other DBs
NCBI-GeneID: 411472
NCBI-ProteinID: XP_006570768
BEEBASE: GB47440
UniProt: A0A088A7W1
AA seq 739 aa
MEALIPVINKLQDVFNTVGADAIQLPQIVVLGTQSSGKSSVIESLVGRSFLPRGTGIVTR
RPLILQLVYTPKDDREHRSAENGTLDLDEWGTFLHTKNKIYIDFSEIRKEIESETERMAG
SNKGICPEPINLKIYSTSVVNLTLIDLPGITKVPVGDQPEDIESQIRQLVLKYICNPNSI
ILAVVTANTDMATSESLKLSKDVDPDGRRTLAVVTKLDLMDAGTDAIDILCGRVIPVKLG
IIGVVNRSQQDIMNNKSIQDALKDEAAFLQRKYPTLANRNGTPYLAKTLNRLLMHHIRDC
LPELKTRVNVMVSQFQTLLNSYGEDVSDKSQTLLQIITKFASSYCSTIEGTARNIETTEL
CGGARICYIFHETFGKTLDSIHPLAGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQ
IRRLEEPSLRCVELVHEEMQRIIQHCGTEVQQEMLRFPKLHERIVDVVTQLLRRRLPPTN
QMVENLVAIELAYINTKHPDFHKDAALVSSLLKNSNVDHIKHNRKVPSTTNTTSSNITSN
EANVKSINNQEEVTSLPEQNKDQGHQMVLSNWLLNNLIPQGRTDSTSSIDNSPVRNRESS
TSPHPNPSSNPIIEVQKASSQQKPVNLLPEVPVQTSRKLSEREQRDCDVIERLIKSYFYI
VRKSIQDSVPKAVMHFLVNYVKDNLQSELVTHLYKSHHAEVLLNESEHVAVRRKEAADML
KALTQAGHIISEIRETHMW
NT seq 2220 nt   +upstreamnt  +downstreamnt
atggaagctttgatacctgtaataaataaattacaagatgtgtttaatactgttggtgct
gatgctatacaattaccacaaatcgtagtacttggtacacagagttcaggaaaatcatct
gtaatagaaagtttagttggtcgatcttttttaccaagaggtactggtatagttactaga
cgtcctttaatattgcaacttgtttatacacctaaagatgatcgtgaacatcgaagtgca
gaaaatggaacattagatctagatgaatggggcacatttttacatactaaaaataaaatt
tacatagattttagtgaaattcgtaaagaaatagaatctgaaacagaacgtatggctgga
tctaataaaggaatttgtccagaaccaattaatttaaagatatattcaacatcagttgtt
aatttaactctcattgatcttcctggtattacaaaagtaccagttggtgaccaaccagaa
gatatcgaaagtcaaatacggcaacttgttttaaaatatatatgtaatcctaattctatt
atattggctgttgttactgcaaacactgatatggctacaagtgaaagtttaaaacttagt
aaagatgtggatccagatggaagacgtacattagctgttgttactaaattggatcttatg
gatgctggaactgatgctatagatatattatgtggaagagttatacctgtaaaattggga
attattggtgtagttaaccgttctcaacaagatataatgaataataaaagtattcaagat
gcattaaaagatgaagctgcatttctgcaacgtaaatatcctactttggcaaacagaaat
ggaactccttatttagctaaaactctaaatcgtttattgatgcatcatattcgggattgt
cttccagaattaaagacgagagtaaatgtcatggtttcacaatttcaaacccttcttaat
tcatatggtgaggatgttagtgacaaaagtcaaactttacttcaaataattactaaattt
gcaagcagttattgttccacaattgaaggaacagctagaaacattgaaacaacagaattg
tgtggtggtgctcgaatttgttatatatttcatgaaacatttggaaaaacattggattcc
atacatccgttggcgggtcttacaaaaatggatattttaacggctattcgaaatgcaact
ggtccaagacctgctctatttgtaccagaggtttcctttgaattattagttaaacgacaa
attcgaagactcgaagaaccgtcattacgatgtgtagaacttgtacatgaagaaatgcaa
agaattattcaacattgtggtactgaagtacagcaagaaatgttacgttttccaaaatta
catgaacgtattgttgatgttgtaacgcaattactacgtcgacgtctcccacctactaat
caaatggttgaaaatttagtcgctatagaattagcatatattaatactaagcatccagat
tttcataaggatgcagctcttgtatcatctttattaaaaaattctaatgtagatcatata
aaacataataggaaagttccttctactacaaataccacatcaagtaatataacttcaaat
gaagcaaatgtaaagtcaattaataatcaagaagaagtgacatctttacctgaacagaat
aaggatcaaggacatcaaatggttttaagcaattggctgttaaataatctcatacctcaa
ggaagaactgattcaactagttcgattgataattctccggtaagaaatcgtgaaagcagt
acttctccccatccaaatccaagttcaaatccaataatcgaagtacagaaagcatcttcg
caacaaaaacctgtaaatctgttacctgaagtaccggtgcaaacatctcgtaaactgagc
gaacgagaacaacgagactgtgatgtgattgaaagattgataaaatcatatttttacatt
gtacgaaaatctatacaagatagtgtaccaaaagctgttatgcatttcttagttaactat
gtaaaagataacttgcaaagtgaacttgtaacacatttatataaatcacatcatgctgaa
gttcttttaaatgaaagtgaacatgttgctgttagacgcaaagaagcagcagatatgcta
aaagcattaacacaagctggtcatattattagtgaaattcgagaaacgcatatgtggtaa

DBGET integrated database retrieval system